Luận văn Nghiên cứu tạo cây thuốc lá chuyên gen kháng sâu

Đề tài có tiến hành ñánh giá tính kháng sâu của một sốdòng thuốc lá chuyển gen trên ñối tượng sâu xanh hại thuốc lá nhưng do một số ñiều kiện khách quan nên chưa thu ñược kết quảcuối cùng. Do ñó trong thời gian tới cần tiếp tục ñánh giá tính kháng sâu và ñánh giá tính ổn ñịnh di truyền ởcác thếhệsau của các dòng thuốc lá mang gen vip3A thu ñược

pdf80 trang | Chia sẻ: lvcdongnoi | Ngày: 17/08/2013 | Lượt xem: 1610 | Lượt tải: 0download
Bạn đang xem nội dung tài liệu Luận văn Nghiên cứu tạo cây thuốc lá chuyên gen kháng sâu, để tải tài liệu về máy bạn click vào nút DOWNLOAD ở trên
ng MS lỏng (khoảng 5 ml), ñổ dịch huyền phù vi khuẩn vào bình chứa các mảnh lá và lắc nhẹ nhàng. Sau 10 phút gắp các mảnh lá lên giấy thấm vô trùng, thấm khô và cấy lên môi trường GM , ñồng nuôi cấy 2 ngày, sau ñó cấy chuyển các mẫu sang môi trường tái sinh ña chồi chọn lọc GM Kan 30. 3.3.3.3 Chọn lọc chồi sau biến nạp Từ những cụm chồi tái sinh trên môi trường chọn lọc, chọn những cụm chồi phân hoá mạnh, tách các cụm chồi có kích thước khoảng 0,5 - 1cm2 cấy chuyển sang môi trường tái sinh ña chồi có bổ sung kháng sinh thích hợp ñể tiếp tục chọn lọc chồi tái sinh. 3.3.3.4 Tái sinh cây hoàn chỉnh Từ những cụm chồi phân hoá mạnh, chọn tách những chồi ñộc lập, có 2 - 3 lá phân hoá rõ ràng, dài từ 2 - 3 cm cấy sang môi trường ra rễ chọn lọc (RM Kan 50). Sau 3 tuần, từ những cây tái sinh hoàn chỉnh và phát triển tốt trên môi trường ra rễ chọn lọc tiếp tục cấy chuyển sang môi trường ra rễ chọn lọc lần 2 ñể thu cây hoàn chỉnh. 3.3.3.5 Ra cây trên giá thể trấu cát: Từ những dòng trên môi trường ra rễ chọn lọc những dòng sinh trưởng phát triển mạnh, cao 5 - 7 cm ñể ra cây vào giá thể trấu : cát (tỉ lệ 1:1). Sau 14 ngày chuyển các dòng vào chậu ñất trong nhà lưới. 3.3.4 Phân tích cây chuyển gen bằng kỹ thuật PCR Sau khi trồng vào bầu ñất, cây hồi phục và ra lá mới thì tiến hành lấy mẫu lá ñể phân tích cây chuyển gen. 3.3.4.1 Quy trình tách chiết DNA tổng số từ lá thuốc lá a. Hoá chất sử dụng: Thành phần dung dịch ñệm Shorty buffer: Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………34 1. 0,2 M Tris - HCl, pH = 9,0 2. 0,4 M LiCl 3. 25 mM EDTA 4. 1% SDS 5. Nước de ion b. Quy trình - Nghiền mẫu lá trong Eppendorf loại 2 ml bằmg Nitơ lỏng thành dạng bột mịn - Bổ sung 500 µl dịch ñệm “Shorty buffer” - Ly tâm 13.000 v/p trong 10 phút - Hút 350 µl dịch nổi chuyển sang Eppendorf loại 1,5 ml có chứa sẵn 35 µl iso-propanol - Mix bằng cách ñảo ngược các ống - Ly tâm 13.000 v/p trong 10 phút - Loại dịch nổi - Bổ sung 700 µl cồn 70%/ống - Ly tâm 13.000 v/p trong 5 phút - Loại bỏ dịch nổi - Làm khô bằng không khí - Bổ sung 50 µl nước ñề ion, lắc nhẹ cho mẫu tan 3.3.4.2 Phản ứng PCR - Thành phần 1 phản ứng PCR Thành phần Thể tích (µl) Nước cất hai lần 10,3 ðệm (10X) 2,0 MgCl2 2,0 Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………35 dNTPs 1,6 Taq polymerase 0,5 Primer F 0,8 Primer R 0,8 DNA mẫu 2,0 Tổng 20,0 - Chương trình thực hiện phản ứng PCR Bước Phản ứng Nhiệt ñộ (oC) Thời gian Chu kỳ 1 Biến tính 94 3 phút 2 Biến tính 94 * 3 Bắt cặp * * 4 Kéo dài 72 * 5 Hoàn tất kéo dài 72 10 phút 6 Kết thúc phản ứng 4 ∞ Từ bước 2 ñến bước 4 thực hiện 35 chu kỳ Ghi chú: *các thông số thay ñổi theo cặp mồi ñặc hiệu Các thí nghiệm ñược bố trí ngẫu nhiên hoàn toàn, lặp lại 3 lần, mỗi thí nghiệm bao gồm 50 mẫu. Thí nghiệm ñược ñặt trong ñiều kiện ánh sáng ñiện 2000 Lux, 16 giờ sáng/8 giờ tối, nhiệt ñộ trong phòng duy trì ở mức 26oC. Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………36 3.4 Các chỉ tiêu theo dõi ∑ số mảnh lá tái sinh ña chồi Tỷ lệ mảnh lá tái sinh ña chồi (%) = x 100 ∑ số mảnh lá biến nạp ∑ số cụm chồi tiếp tục tái sinh ña chồi Tỷ lệ cụm chồi tái sinh (%) = x 100 ∑ số cụm chồi sau biến nạp ∑ số chồi ra rễ Tỷ lệ cây ra rễ (%) = x 100 ∑ số chồi ñưa vào chọn lọc ∑ số cây sống sót Tỷ lệ cây sống sót (%) = x 100 ∑ số cây ñưa ra Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………37 4. KẾT QUẢ VÀ THẢO LUẬN 4.1 Thiết kế vector pBI121 mang gen vip3A ðể tạo cây thuốc lá chuyển gen mang gen vip3A, việc thiết kế vector mang gen vip3A ñể chuyển vào cây trồng là một bước quan trọng trong toàn bộ quá trình tạo cây chuyển gen. Sơ ñồ 4.1: Sơ ñồ thiết kế vector pBI121 mang gen vip3A Gen vip thuộc nhóm gen mã hoá protein Vip (vegetative insecticidal protein) (protein có trọng lượng phân tử 80 - 90 kDa) xuất hiện trong pha sinh trưởng sinh dưỡng và sinh sản của chu trình phát triển của vi khuẩn Bt, gây 35S gus NOST BamHI SacI S¶n phÈm PCR vip3A vip3A BamHI SacI Bam HI & SacI BamHI SacI 35S NOST BamHI SacI T4 ligase 35S NOST vip3A Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………38 ñộc với hầu hết côn trùng bộ cánh vảy (Lepidoptea), ngoài ra còn gây ñộc ñối với một số côn trùng bộ cánh cứng (Coleoptera) và hai cánh (Diptera). Trong nhóm gen vip thì gen vip3A ñược ñặc biệt quan tâm nghiên cứu vì chúng mã hóa cho các protein có hoạt lực diệt sâu mạnh cùng với phổ hoạt ñộng rộng. Protein Vip3A có thể kháng cả một số côn trùng thuộc bộ cánh vảy mà protein Cry hầu như không có tác dụng. Gen sử dụng trong thí nghiệm là kết quả phân lập của nhóm nghiên cứu thuộc Phòng công nghệ tế bào thực vật - Viện công nghệ sinh học. Gen mã hóa cho protein có kích thước 2369 bp, mã hoá 793 axít amin, ñược công bố trên ngân hàng gen quốc tế (mã số AJ971413). 4.1.1 Thiết kế mồi ðể nhân thành công một gen, ñiều kiện ñầu tiên là có cặp mồi ñặc hiệu của gen ñó. Cặp mồi ñặc hiệu V2.1 và V2.2 ñược thiết kế ñể nhân gen vip3A dựa trên cơ sở trình tự gen vip3A ñã ñược công bố (phụ lục 2). Ngoài ra mồi V2.3 ñược thiết kế thêm ñể kiểm tra sự có mặt của gen vip3A trong cây sau khi chuyển gen. Các mồi này có những trình tự và thông số cần thiết thể hiện trên bảng 4.1. Bảng 4.1. Trình tự và những thông số liên quan của cặp mồi nhân gen vip3A STT Trình tự mồi Tm %GC Vị trí gắn V2.1 5'-GCGGATCCATGAACAAGAATAATACTAA-3' 61oC 42,8 1 - 20 V2.2 5'-CGGAGCTCTTACTTAATAGAGCATCGTA-3' 62,5oC 42,8 2350-2370 V2.3 5'-GGAGAGCCATCCTTTTTTACTT-3' 55oC 40,9 579 - 605 Trên cặp mồi nhân vip3A ñược thiết kế thêm ñiểm cắt của 2 enzyme giới hạn là BamHI và SacI ñể phục vụ cho việc thiết kế vector chuyển gen sau này. Mồi xuôi (V2.1) gắn từ vị trí 1 ñến vị trí 20, mồi ngược (V2.2) gắn từ vị trí số 2370 về vị trí số 2350, mồi ngược V2.3 gắn từ vị trí 605 về vị trí số 579. Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………39 GGATCC: ñiểm cắt của enzyme giới hạn BamHI GAGCTC: ñiểm cắt của enzyme giới hạn SacI 4.1.2 PCR nhân ñoạn gen vip3A và tinh sạch sản phẩm PCR Theo lý thuyết, nếu ta cung cấp cặp mồi ñặc hiệu thì sẽ nhân chính xác ñược ñoạn gen nằm giữa hai mồi ñó. Cặp mồi ñược thiết kế ñể nhân toàn bộ gen vip3A có kích thước 2370 bp, nếu phản ứng PCR xảy ra ñặc hiệu thì theo lý thuyết sẽ thu ñược băng duy nhất có kích thước khoảng 2,4 kb. Kết quả ñiện di sản phẩm PCR cho thấy ñoạn DNA mã hoá protein Vip3A ñã ñược nhân lên một cách ñặc hiệu, chỉ tạo ra một sản phẩm duy nhất có kích thước khoảng 2,4 kb, phù hợp với kích thước gen vip3A dự kiến. Sản phẩm PCR sau ñó ñược tinh sạch theo bộ Kit thôi gel (Gel purification Kit) của hãng Bioneer và ñiện di kiểm tra sản phẩm sau khi tinh sạch. Kết quả ñược thể hiện trên hình 4.1. Hình 4.1: Kết quả ñiện di tinh sạch sản phẩm PCR nhân gen vip3A 1: marker 2: Tinh sạch sản phẩm PCR nhân gen vip3A Ảnh chụp cho thấy một băng duy nhất có kích thước 2,4 kb, không có 2,4 kb 2,0 kb 2,5 kb 1 2 Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………40 vạch phụ chứng tỏ sản phẩm sau tinh sạch ñạt yêu cầu ñể dùng cho các thí nghiệm tiếp theo. 4.1.3 Ghép nối ñoạn gen vip3A vào vector tách dòng Sản phẩm tinh sạch PCR ñược gắn trực tiếp vào vectơ tách dòng pCR@ 2.1-TOPO của hãng Invitrogen ñược cung cấp ở dạng mạch thẳng có bazơ thiamin nhô ra ở ñầu 3'. Do ñặc tính của Taq - polymerase nên sản phẩm PCR có ñến hơn 70% là có thêm bazo Adenin ở ñầu 3' do vậy việc liên kết giữa gen và vector có hiệu quả cao. Phản ứng nối ghép ñược ủ qua ñêm ở nhiệt ñộ 14oC ñể thu plasmit tái tổ hợp. 4.1.4 Biến nạp plasmit tái tổ hợp vào tế bào khả biến E.coli DH5α Sản phẩm của phản ứng ghép nối ñược biến nạp vào tế bào khả biến E.coli chủng DH5α theo phương pháp sốc nhiệt (Cohen và cộng sự, 1972), sau ñó ñược cấy trải trên môi trường LB ñặc có bổ sung ampicillin (100 µg/l), X- gal (100 µg/l) và chất cảm ứng IPTG 0,1M, nuôi qua ñêm. Kết quả ñược thể hiện trên hình 4.2. Hình 4.2 : Kết quả biến nạp plasmit tái tổ hợp vào tế bào khả biến E.coli DH5α Trên ñĩa nuôi cấy thu ñược cả khuẩn lạc xanh và khuẩn lạc trắng. Khuẩn lạc xanh là do trong vector pCR@ 2.1-TOPO có chứa gen lacZ, nếu hoạt ñộng bình thường sẽ tổng hợp enzyme β - galactosidase và dưới sự cảm Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………41 ứng của IPTG chuyển hoá cơ chất X - gal thành hợp chất có màu xanh. ðó là những vi khuẩn không có ñoạn DNA ngoại lai chèn vào. Khuẩn lạc trắng là do gen lacZ ñã bị ñoạn gen DNA ngoại lai chèn vào giữa nên không tổng hợp ñược enzyme β - galactosidase và ñây có thể là những khuẩn lạc có thể chứa plasmit tái tổ hợp. 4.1.5 Chọn lọc plasmit tái tổ hợp Việc kiểm tra xem các khuẩn lạc có chứa các plasmit tái tổ hợp hay không là việc rất quan trong ñể chọn vật liệu chính xác cho các thí nghiệm tiếp theo. Chọn ngẫu nhiên 10 dòng khuẩn lạc trắng, nuôi lỏng và tách chiết DNA plasmit, ñiện di trên agarose 0,8%, sau ñó cắt kiểm tra bằng hai enzyme BamHI và SacI. Kết quả ñiện di sản phẩm cắt thể hiện trong hình 4.3. Hình 4.3: Kết quả ñiện di sản phẩm cắt plasmit 1: Marker 2 - 11: Các plasmit tách từ khuẩn lạc trắng ñược cắt bằng BamHI và SacI : 12: Plasmit tách từ khuẩn lạc xanh ñược cắt bằng EcoRI 13: Plasmit tách từ khuẩn lạc trắng ñối chứng không cắt Các plasmit tái tổ hợp ñược tách từ khuẩn lạc trắng sau khi ñược cắt Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………42 bằng hai enzyme giới hạn BamHI và SacI cho ra hai băng DNA có kích thước khác nhau, băng trên có kích thước khoảng 3,9 kb, là kích thước của vector pCR@ 2.1-TOPO, băng ở phía dưới có kích thước khoảng 2,4 kb, tương ñương với kích thước sản phẩm PCR của gen vip3A. Như vậy chứng tỏ ñiểm cắt hai enzyme BamHI và SacI ñã có mặt trong hai ñầu ñoạn gen vip3A. Khuẩn lạc xanh ñược cắt bằng enzyme EcoRI thì cho một băng duy nhất có kích thước 3,9 kb. Như vậy có thể kết luận việc nối ghép sản phẩm PCR và vector tách dòng ñã ñạt kết quả mong muốn. Chọn một dòng khuẩn lạc dương tính ñã ñược kiểm tra chính xác trình tự gen vip3A ñể làm nguyên liệu cho các nghiên cứu tiếp theo. 4.1.6 Tạo vector chuyển gen mang gen vip3A Vector pBI121 có kích thước 13,0 kb ñược thiết kế dựa trên cấu trúc của vector pBIN19, một vector chuyển gen vào thực vật. Vector pBI121 mang một vị trí cắt duy nhất của BamHI và SacI ở hai ñầu gen gus (phụ lục 3) Plasmit tái tổ hợp cũng có vị trí cắt duy nhất của hai enzyme giới hạn BamHI và SacI nên chúng tôi tiến hành cắt ñồng thời vector pBI121 và plasmit tái tổ hợp bằng enzyme BamHI và SacI. Theo lý thuyết thì sản phẩm cắt của pBI121 sẽ có hai băng tương ứng với kích thước khoảng 11,2 kb và 1,8 kb (kích thước của gen gus). Sản phẩm cắt của plasmit tái tổ hợp sẽ có hai băng khoảng 3,9 kb (tương ứng với kích thước của vector pCR@2.1 gốc) và 2,4 kb (kích thước của gen vip3A). Kết quả ñiện di thể hiện trên hình 4.4. ðường chạy số 2 là kết quả cắt của plasmit tái tổ hợp tương ứng với kích thước khoảng 3,9 kb và 2,4 kb. ðường chạy số 3 là sản phẩm cắt của pBI121, chỉ xuất hiện hai băng có kích thước tương ứng là 11,2 kb và 1,8 kb. Như vậy kết quả cắt enzyme hoàn toàn phù hợp với dự ñoán theo lý thuyết, chứng tỏ kết quả cắt enzyme tốt. Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………43 Hình 4.4: Sản phẩm cắt bằng enzyme BamHI& SacI 1: Marker 2: Vector tách dòng 3: Vector pBI121 Trên sản phẩm cắt của pBI121 thôi và tinh sạch ñoạn gel có kích thước 11,2 kb (vector pBI121 ñã loại bỏ gen gus). Trên sản phẩm cắt của vector tái tổ hợp thôi và tinh sạch ñoạn gel có kích thước 2,4 kb (gen vip3A). Hai sản phẩm này sẽ ñược sử dụng làm nguyên liệu cho phản ứng ghép nối bằng enzyme T4 ligaza và biến nạp sản phẩm ghép nối vào tế bào khả biến E.coli chủng DH5α, cấy trải trên môi trường LB ñặc có bổ sung kháng sinh Kan nồng ñộ 25 mg/l và ủ ở 37oC qua ñêm. Chọn ngẫu nhiên 14 dòng khuẩn lạc mọc trên ñĩa môi trường có kháng sinh chọn lọc, tách plasmit, tiến hành phản ứng PCR với cặp mồi ñặc hiệu nhân gen vip3A nhằm tìm ra chính xác dòng khuẩn lạc mang vector pBI121 tái tổ hợp mong muốn. Kết quả ñiện di sản phẩm PCR ñược thể hiện trên hình 4.5. Kết quả trên hình 4.5 cho thấy chỉ có duy nhất dòng số 13 xuất hiện băng có kích thước 2,4 kb, tương ứng với kích thước của gen vip3A chứng tỏ dòng số 13 mang cấu trúc vector pBI121/vip3A tái tổ hợp. Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………44 Hình 4.5: Kết quả ñiện di sản phẩm PCR từ 14 dòng khuẩn lạc cặp mồi ñặc hiệu V1.2/V2.2 1: marker; 2 - 15: 14 dòng khuẩn lạc Tách plasmit của dòng số 13 ñể dùng làm vật liệu tiến hành phản ứng cắt kiểm tra bằng BamHI và SacI. Kết quả ñiện di sản phẩm cắt của dòng khuẩn lạc số 13 ñược thể hiện trên hình 4.6. Trên ñường chạy số 2 xuất hiện hai băng: một băng có kích thước 11,2 kb (kích thước của pBI121 ñã cắt gen gus); một băng có kích thước 2,4 kb (kích thước gen vip3A), phù hợp với dự ñoán lý thuyết. Từ những kết quả trên có thể kết luận chính xác dòng khuẩn lạc số 13 mang vector pBI121 tái tổ hợp mong muốn. Dòng khuẩn lạc này ñược giữ chủng ñể làm vật liệu cho các nội dung thí nghiệm tiếp theo. Như vậy vector chuyển gen pBI121 tái tổ hợp mang gen vip3A ñã ñược thiết kế tthành công, ñặt tên là pBI121/vip3A. Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………45 Hình 4.6: Kết quả ñiện di kiểm tra sản phẩm phản ứng cắt plasmit tái tổ hợp bằng enzyme BamHI & SacI 1: Marker; 2: pBI121 /vip3A cắt bằng BamHI & SacI 4.2 Chuyển gen vip3A vào cây thuốc lá 4.2.1 Biến nạp vector mang gen vip3A vào tế bào A. tumerfaciens bằng xung ñiện Chuyển gen vào thực vật gián tiếp thông qua vi khuẩn A.tumerfaciens là phương pháp phổ biến ñược ưu tiên lựa chọn của các nhà khoa học và các nhà chọn tạo giống cây trồng. Trong nghiên cứu này chúng tôi cũng sử dụng phương pháp chuyển gen vip3A vào cây thuốc lá thông qua vi khuẩn A.tumerfaciens. Sau khi thiết kế thành công vector mang gen vip3A, vector mang gen vip3A ñược biến nạp vào vi khuẩn A.tumerfaciens chủng C58. Plasmit tái tổ hợp ñược tách chiết từ chủng vi khuẩn mang vector pBI121/vip3A, sản phẩm ñược biến nạp vào tế bào khả biến của vi khuẩn A.tumerfaciens chủng C58 bằng phương pháp xung ñiện. Sản phẩm sau khi biến nạp ñược nuôi cấy trên môi trường chọn lọc. Một số dòng khuẩn lạc dương tính tiếp tục ñược kiểm tra sự có mặt của vector mang gen vip3A bằng phương pháp cắt enzyme giới hạn tương tự bước kiểm tra trong E.coli. Chọn một dòng khuẩn lạc dương tính (A.tumerfaciens/C58/vip3A) làm nguyên liệu chuyển gen vip3A vào mảnh lá thuốc lá. Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………46 4.2.2 Chuyển cấu trúc mang gen vip3A vào cây thuốc lá thông qua vi khuẩn A. tumefaciens Chuyển gen kháng sâu vip3A vào cây thuốc lá thông qua vi khuẩn A.tumerfaciens chủng C58 chứa vector pBI121/vip3A cũng là một bước quan trọng trong toàn bộ quá trình tạo ñược cây chuyển gen. Hệ thống tái sinh cây thuốc lá tương ñối ñơn giản và thời gian tái sinh từ mô lá ñến cây hoàn chỉnh ngắn (khoảng 3 tháng) và tỷ lệ tái sinh cao [8] nên quy trình tạo cây thuốc lá chuyển gen ñã ñược nghiên cứu nhiều. Trong nghiên cứu này chúng tôi áp dụng theo quy trình chuyển gen quan tâm vào cây thuốc lá thông qua A.tumerfaciens theo phương pháp Topping cải tiến (Topping, 1998) (phụ lục 4). Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………47 Sơ ñồ 4.2: Sơ ñồ chuyển gen vip 3A vào thuốc lá thông qua A.tumerfaciens Dịch huyền phù vi khuẩn Tái sinh ña chồi Ra rễ (Mảnh lá ngâm trong dung dịch huyền phù vi khuẩn) Biến nạp Mảnh lá thuốc lá trong môi trường GM trước khi biến nạp Trồng cây trong bầu ñất Ra cây bầu trấu : cát Vi khuẩn trên môi trường LB ñặc Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………48 Tạo dịch huyền phù vi khuẩn: Dòng khuẩn lạc A.tumerfaciens dương tính mang gen vip3A ñược nuôi hồi phục ñể thu dịch huyền phù phục vụ cho nội dung chuyển gen. Khuẩn lạc mọc tốt trên môi trường có kháng sinh chọn lọc (hình 4.7). Hình 4.7. Vi khuẩn A.tumerfaciens/ C58 /vip3A trên môi truờng LB ñặc chọn lọc Hình 4.8. Dịch huyền phù vi khuẩn Dịch huyền phù vi khuẩn thu ñược có giá trị ño OD660nm = 0,75, ñủ ñiều kiện ñể biến nạp vào mảnh lá thuốc lá (hình 4.8) Sau biến nạp, các mảnh lá ñược ñồng nuôi cấy hai ngày trên môi trường GM và chuyển sang môi trường chọn lọc Kan 30. Sau 3 tuần các cụm chồi ñược tách và cấy chuyển sang môi trường chọn lọc Kan 50. Những chồi phát triển tốt sẽ ñược tách ra và cấy chuyển sang môi trường chọn lọc Kan 50 một lần nữa. Sau ñó chồi ñược cấy chuyển sang môi trường ra rễ tạo cây hoàn chỉnh. Kết quả theo dõi quá trình tái sinh của các dòng qua các giai ñoạn khác nhau thể hiện trong bảng 4.2. Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………49 Bảng 4.2: Tỷ lệ tái sinh/sống sót của các mẫu qua các giai ñoạn (%) Công thức Mảnh lá Cụm chồi Ra rễ Kan 50 (lần 1) Ra rễ Kan 50 (lần 2) Giá thể trấu : cát Bầu ñất CTTN 77,7 82,3 73,3 81,8 93,3 88,1 ð/C1 0,0 0,0 0,0 0,0 - - ð/C2 93,3 96,7 96,7 96,6 100,0 100,0 LSD5% 6,9 3,4 4,6 4,9 CV% 6,1 2,8 4,0 4,1 Ghi chú: CTTN: công thức thí nghiệm ð/C1: mẫu không biến nạp cấy trên MT có bổ sung kháng sinh chọn lọc ð/C2: mẫu không biến nạp cấy trên MT không bổ sung kháng sinh Giai ñoạn chọn lọc mảnh lá tái sinh ña chồi sau biến nạp Ở CTTN, số mảnh lá tái sinh ña chồi trên môi trường chọn lọc GM Kan 30 khá cao (77,7%) (hình 4.9). Theo lý thuyết những dòng tái sinh ñược trên môi trường có kháng sinh Kan là do trong genom của chúng có mang gen kháng Kan. Do vậy có thể tạm kết luận ñây là những mẫu ñã biến nạp thành công vì có sự tồn tại của gen kháng Kan trong tế bào mảnh lá nên các mảnh lá tiếp tục tái sinh ña chồi trên môi trường GM có kháng sinh Kan trong khi ở ð/C1 các mảnh lá không tái sinh ña chồi, vàng dần và chết (hình 4.10) chứng tỏ trong tế bào của các mảnh lá không biến nạp không chứa gen kháng Kan nên chúng không thể tái sinh trên môi trường có kháng sinh này còn ð/C 2 có tỷ lệ mẫu phân hóa thành cụm chồi trên môi trường GM là 93,3% (hình 4.11). Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………50 Hình 4.9: Mảnh lá CTTN trên MT GM Kan 30 Hình 4.10: Mảnh lá ð/C1 trên MT GM Kan 30 Hình 4.11: Mảnh lá ð/C2 trên MT GM Giai ñoạn chọn lọc cụm chồi sau biến nạp: Những cụm chồi ở CTTN ñược cắt nhỏ và chuyển sang môi trường tái sinh ña chồi GM Kan 50 ñể tiếp tục chọn lọc còn những cụm chồi ở ð/C2 ñược dùng làm vật liệu cho ð/C 1 và ð/C2 ở giai ñoạn chọn lọc cụm chồi. Số cụm chồi tiếp tục phân hoá trên môi trường chọn lọc (GM Kan 50) ñạt 82,3% , các cụm chồi còn lại phân hoá chậm và vàng dần (hình 4.12). Như vậy có thể ở những cụm chồi không tiếp tục phân hóa là do các gen kháng Kan ñược chuyển vào nhưng không tiếp tục phiên mã nên không tái sinh trên môi trường chọn lọc trong khi ð/C1 100% các cụm chồi phân hóa chậm hoặc ngừng phân hoá ,vàng dần và chết (hình 4.13) còn ð/C2 có tỷ lệ mẫu tái sinh trên môi trường là 96,7 % (hình 4.14). Hình 4.12: Cụm chồi CTTN trên MT GM Kan 50 Hình 4.13: Cụm chồi ð/C1 trên MT GM Kan 50 Hình 4.14: Cụm chồi ð/C2 trên MT GM Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………51 Giai ñoạn chọn lọc cây tái sinh hoàn chỉnh: Những chồi khỏe sẽ ñược tách ra và chuyển dang môi trường ra rễ (RM Kan 50) ñể tạo cây hoàn chỉnh. Số chồi tái sinh thành cây hoàn chỉnh và sinh trưởng tốt trên môi trường RM chọn lọc lần 1 (Kan 50) ñạt 73,3% , trên môi trường RM chọn lọc lần 2 (Kan 50) ñạt 81,8%, phần còn lại không ra rễ, sinh trưởng chậm hoặc ngừng sinh trưởng (hình 4.15, 4.16 và 4.18) trong khi ð/C1 có 100% chồi không ra rễ, vàng dần và chết (hình 4.17 và 4.19) còn ð/C2 có 96,55% chồi tái sinh thành cây hoàn chỉnh. Hình 4.15: Cây tái sinh trên MT RM Kan 50 (chọn lần 1) Hình 4.16: Cây tái sinh trên MT RM Kan 50 (chọn lần 2) Hình 4.17: Cây ð/C trên MT RM Kan 50 Hình 4.18: Rễ cây chuyển gen trên môi trường RM Kan 50 Hình 4.19: Rễ cây ð/C trên môi trường RM Kan 50 Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………52 Như vậy có thể kết luận việc chuyển gen và chọn lọc cây sau chuyển gen invitro ñã ñược hoàn thành. Giai ñoạn ra cây vào giá thể trấu : cát (tỷ lệ 1:1) Từ những dòng chọn lọc trên môi trường RM (Kan 50), chọn ngẫu nhiên 22 dòng thuốc lá chuyển gen ñể ra cây vào giá thể trấu : cát (tỉ lệ 1: 1). ðây là bước chuyển cây từ giai ñoạn cung cấp các ñiều kiện sống tối ưu trong phòng sang giai ñoạn cây tự tổng hợp, ñồng hóa và dị hóa các chất từ ñiều kiện tự nhiên ñể phục vụ cho các hoạt ñộng sống của mình. Bước chuyển cây ra giá thể ñược coi như bước trung gian ñể cây cây thích nghi từ từ với ñiều kiện ngoại cảnh và ra rễ mới. Với ñặc ñiểm hệ rễ phụ của cây thuốc lá phát triển mạnh, có thể phát triển những ñốt thân gần gốc nên tỷ lệ sống của các dòng khi vào giá thể khá cao (91,3%), hệ rễ mới phát triển mạnh, chứng tỏ sự thích nghi của cây với ñiều kiện ngoại cảnh khá tốt (hình 4.20), là tiền ñề ñể có những cây khỏe mạnh khi cây sống trong ñiều kiện ngoại cảnh mới. Giai ñoạn trồng ra bầu ñất: ðây là giai ñoạn cây ñược chuyển sang ñiều kiện tự dưỡng trong ñiều kiện ngoại cảnh mới. Sau 14 ngày chuyển các dòng sống trên giá thể trấu : cát vào chậu ñất ñặt trong nhà lưới. Tỷ lệ sống của các dòng khi trồng ra chậu vại ñất là 90 % (tương ñương với ð/C) (hình 4.20) chứng tỏ cây thích nghi tốt với ñiều kiện ngoại cảnh. Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………53 Hình 4.20: Cây trong bầu trấucát Hình 4.21: Cây trồng trong bầu ñất Như vậy quá trình chuyển gen vào cây thuốc lá, chọn lọc sau biến nạp, tái sinh cây hoàn chỉnh trên môi trường chọn lọc và trồng cây ra bầu ñất ñã hoàn thành. 4.3 Kiểm tra và theo dõi kết quả chuyển gen Xác ñịnh xem gen ñược chuyển vào có tiếp tục phiên mã và hoạt ñộng trong cây hay không bằng cách kiểm tra sự có mặt của gen câu trúc mang gen vip3A chuyển vào bằng phản ứng PCR với cặp ñoạn mồi ñặc hiệu. Sơ ñồ 4.3: Các bước kiểm tra sự có mặt của gen vip3A trong chuyển gen PCR cho phép nhân bản một số lượng lớn nguyên bản một ñoạn DNA trong một thời gian ngắn. ðây là phương pháp thường ñược dùng trong phân tích dòng cây chuyển gen vì ñộ tin cậy cao. Theo lý thuyết nếu ta cung cấp cặp mồi ñặc hiệu thì sẽ nhân chính xác ñược ñoạn gen nằm giữa hai mồi ñó. Khi tiến hành PCR trên DNA tách từ cây ñã ñược chuyển gen, nếu cho kết Nhuộm bản gel ðiện di Tách chiết DNA Mẫu lá PCR Chụp ảnh Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………54 quả ñặc hiệu với cặp mồi ñó thì ta có thể kết luận rằng cây ñó ñã mang ñoạn gen cần chuyển. Vào giai ñoạn 30 ngày sau trồng, khi cây ñã mọc ra lá mới và phát triển bình thường thì tiến hành thu mẫu lá non của 22 dòng thuốc lá chuyển gen ñể tách chiết DNA tổng số. Các mẫu DNA ñược kiểm tra với cặp mồi 35S Fs/Rs. Cặp mồi 35S Fs/Rs ñược thiết kế nhân ñoạn gen có kích thước 314 bp. Kết quả ñiện di sản phẩm PCR của 22 dòng thuốc lá chuyển gen ñược thể hiện trong hình 4.22 a,b. Hình 4.22 a: Kết quả ñiện di sản phẩm PCR của 16 dòng thuốc lá với cặp mồi 33S Fs/Rs Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………55 Hình 4.22 b: Kết quả ñiện di sản phẩm PCR của 6 dòng thuốc lá với cặp mồi 35S Fs/Rs M: marker; 1-22: các dòng thuốc lá chuyển gen ñ/c (-) : mẫu lá cây không chuyển gen ñ/c (+): plasmit tách từ khuẩn A.tumerfaciens C58/vip3A Toàn bộ 22 dòng thuốc lá chuyển gen (100%) ñều cho một băng duy nhất ở vị trí khoảng 300 bp, phù hợp với kích thước tính toán ban ñầu chứng tỏ trong các dòng thuốc lá chuyển gen ñều có sự có mặt của promotor 35S có trong cấu trúc vector pBI121/vip3A ñược thiết kế trong nghiên cứu. Các mẫu ñược kiểm tra lại bằng cặp mồi ñặc hiệu ñể nhân gen vip3A.. Cặp mồi ñược thiết kế nhân ñoạn gen từ vị trí 1 ñến vị trí 605. Kết quả ñiện di sản phẩm PCR của 22 dòng với cặp mồi V2.1/V2.3 ñược thể hiện trong hình 4.23. Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………56 Hình 4.23: Kết quả ñiện di sản phẩm PCR của 22 dòng thuốc lá với cặp mồi V2.1/V2.3 M: marker 1kb; 1-22: các dòng thuốc lá chuyển gen; ñ/c (-): cây không chuyển gen; ñ/c (+): plasmit tách từ chủng khuẩn A.tumerfaciens/C58/vip3A Có 19/22 dòng thuốc lá (86,4%) cho một băng duy nhất ở vị trí khoảng 600 bp, phù hợp với tính toán lý thuyết. Ba dòng còn lại không cho băng như dự kiến, có thể do quá trình trao ñổi chất và tự nhân lên của tế bào có ñột biến hoặc xảy ra hiện tượng trao ñổi chéo, ñứt gẫy, ñột biến... nên gen vip3A chuyển vào không còn nguyên vẹn, cặp mồi không tìm ñược vị trí ñể bắt cặp vào nên ñoạn gen dự kiến không ñược nhân lên. Như vậy gen vip3A ñã ñược chuyển thành công và tiếp tục phiên mã trong 19/22 (86,4%) dòng thuốc lá chuyển gen ñược lựa chọn ngẫu nhiên ñể kiểm tra. Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………57 5. KẾT LUẬN VÀ KIẾN NGHỊ 5.1 Kết luận 5.1.1 Thiết kế thành công vector chuyển gen pBI121/vip3A mang gen kháng sâu vip3A dưới sự ñiều khiển của promoter 35S. 5.1.2 ðã tạo ra trên một trăm dòng thuốc lá chuyển gen mang gen vip3A sống sót trên môi trường chứa kháng sinh chọn lọc Kan 50. Tỷ lệ tái sinh ña chồi của mảnh lá thuốc lá sau biến nạp ñạt 77,7%, của cụm chồi ñạt 82,3%. Tỷ lệ tái sinh thành cây hoàn chỉnh ñạt từ 73,3% ñến 81,8%. Trong 22 dòng thuốc lá chọn ngẫu nhiên ñể ra cây: Tỷ lệ sống sót của cây khi ra bầu trấu : cát (1:1) ñạt 91,3%, khi trồng ra chậu ñất ñạt 90%. 5.1.3 Kiểm tra sự có mặt của gen vip3A trong 22 dòng thuốc lá ñược chọn lọc ngẫu nhiên với 2 cặp mồi ñặc hiệu là 35S Fs/Rs và V2.1/V2.3: - Toàn bộ 22 dòng thuốc lá chuyển gen (100%) ñều có mặt của promotor 35S trong cây ở thế hệ T0. - 19/22 dòng thuốc lá chuyển gen (86,4%) có mặt gen vip3A trong cây ở thế hệ T0. 5.2 Kiến nghị - ðề tài có tiến hành ñánh giá tính kháng sâu của một số dòng thuốc lá chuyển gen trên ñối tượng sâu xanh hại thuốc lá nhưng do một số ñiều kiện khách quan nên chưa thu ñược kết quả cuối cùng. Do ñó trong thời gian tới cần tiếp tục ñánh giá tính kháng sâu và ñánh giá tính ổn ñịnh di truyền ở các thế hệ sau của các dòng thuốc lá mang gen vip3A thu ñược. Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………58 TÀI LIỆU THAM KHẢO A. TÀI LIỆU TRONG NƯỚC 1. ðái Duy Ban, Lữ Thị Cẩm Vân (1994). Công nghệ gen và công nghệ sinh học dùng trong nông nghiệp hiện ñại. NXB Nông nghiệp. 2. Vũ Thị Bản, ðào ðức Thức, Chu Hoàng Hà. Nghiên cứu chọn tạo giống thuốc lá vàng sấy kháng bệnh virus TMV (bệnh khảm lá. Báo cáo khoa học 2007 3. Lê Trần Bình, Hồ Hữu Nhị, Lê Thị Muội (1997). Công nghệ sinh học thực vật trong cải tiến giống cây trồng. NXB Nông Nghiệp. 4. Lê Trần Bình, Phan Văn Chi, Nông Văn Hải, Trương Nam Hải, Lê Quang Huấn (2003). Áp dụng các kĩ thuật phân tử trong nghiên cứu tài nguyên sinh vật Việt Nam. NXB Khoa học và kĩ thuật. 5. Bộ môn cây công nghiệp Trường ñại học nông lâm Thành Phố Hồ Chí Minh. Giáo trình giảng dạy cây thuốc lá. 6. Nguyễn Liên Chi, Nguyên Hữu Hồ, Nguyễn Văn Uyển, 1989. Chuyển gen kháng kanamycin vào mô thuốc lá (N.tabacum) và mô lá cây cà úc bằng vi khuẩn A.tumefaciens . Tạp chí di truyền 1/1989 7. Lê Việt Hùng, 1994: Thực trạng sản xuất nguyên liệu thuốc lá vàng ở một số tỉnh phía Bắc: Những suy nghĩ từ khía cạnh kinh tế. Tạp chí Công nghiệp nhẹ t. 10 (trang 105-108). 8. Trần ðăng Kiên, Nông Văn Hải, Vũ ðức Quang, Trần Thị Vui, ðào Thị Xuân. Nghiên cứu phương pháp biến nạp gen tạo giống thuốc lá có khả năng kháng sâu bệnh. Báo cáo ñề tài khoa học 1999. . 9. Hoàng Tự Lập và cs. Giáo trình thi nâng ngạch viên chức Tổng công ty Thuốc lá Việt Nam năm 2008 - 2009. 10. Trần Phương Liên, Nông Văn Hải, Lê Xuân Tú, 1994. Nghiên cứu biến Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………59 nạp một số gene chọn lọc vào các dòng thuốc lá bằng cách sử dụng Ti-plasid vector. Hội nghị công nghệ sinh học toàn quốc 1994 11. Nguyễn ðức Thành, Nghiêm Ngọc Minh, Lê Diệu Muội, 1994. Nghiên cứu chuyển gen lục lạp thuốc lá. Hội nghị công nghệ sinh học toàn quốc 1994 12. Nguyễn Quang Thạch, (chủ biên), Nguyễn Thị Lý Anh, Nguyễn Thị Phương Thảo (2005). Giáo trình công nghệ sinh học nông nghiệp. NXB NN - Hà Nội. 13. Nguyễn Quang Thạch. Bài giảng công nghệ sinh học thực vật. ðại học Nông nghiệp Hà nội. 14. Lê ðình Thụy, Phạm Kiến Nghiệp, 1996. Trồng và chế biến thuốc lá. NXB T/p Hồ Chí Minh 15. Viện kinh tế kỹ thuật thuốc lá: Dự báo sản xuất và tiêu dùng thuốc lá ñến 2010 (báo cáo nội bộ). B.TÀI LIỆU NƯỚC NGOÀI 16. Akehurt B. C. 1981: Tobacco. Longman group Ltd., New York. 764 pp. 17. Berliner E (1915) [About the sleep sickness of the Ephestia kühniella Zell. and its vector Bacillus thuringiensis.] Z Angew Entomol, 2: 29–56 (in German). 18. Carozzi, N.B., Warren, G.W., Desai, N., Jayne, S.M., Lotstein, R., Rice, D.A., Evola, S. and Koziel, M.G. (1992). Expression of a chimeric CaMV35S Bacillus thuringiensis insecticidal protein in transgenic tobacco. Plant Molecular Biology 20: 539-548. 19. Chen, J.J., Yu, J.X., Tang, L.X, Tang, M.J., Shi, Y.X. and Pang, Y. (2003) Comparison of the expression of Bacillus thuringiensis fulllength and N-terminally truncated vip3A gene in Escherichia coli. Journal of Applied Microbiology 9: 310-316 Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………60 20. Collins W. K ; Hawks S. N. Jr.: Principles of the Flue - cured Tobacco Production. N. C. State University 2nd Ed. 1993. 300. 21. Crickmore, N., Ziegler, D.R., Fietelson, J., Schnepf, E.,Van Rie, J., Lereclus, D., Baum, J. and Dean, D.H. (1998). Revision of the nomenclature for Bacillus thuringiensis pesticidal crystal proteins. Microbiology and Molecular Biology Review 62:807-813. 22. Davis D. L.; Nielsen M. T. 1999: Tobacco Production, Chemistry and Technology. B Blackwell Science. 467. 23. English, L. and Slatin, S.L. (1992). Mode of action of δ-endotoxins from Bacillus thuringiensis: A comparison with other bacterial toxins. Insect Biochemistry and Molecular Biology 22:1-7. 24. Estruch, J.J., Carozzi, N.B., Desai, N., Duck, N.B., Warren, G.W. and Koziel, M.G. (1997). Transgenic plants: an emerging approach to pest control. Nature Biotechnology 15:137-141. 25. Estruch, J.J., Warren, G.W., Mullins, M.A, Nye, G.J., Craig, J.A. and Koziel, MG. (1996) Vip3A, a novel Bacillus thuringiensis vegetative insecticidal protein with a wide spectrum of activities against lepidopteran insects. Proceedings of the National Academy of Sciences of the United States of America 93: 5389-5394. 26. Estruch, J.J., Warren, G.W., Mullins, M.A., Nye, G.J., Craig, J.A. and Koziel, M.G. (1996). Vip3A, a novel bacillus thuringiensis vegetative insecticidal protein with a wide spectrum of activities against lepidopteran insects. Proceedings, National Academy of Sciences, USA 93:5389-5394. 27. Federici, B.A. (1998). Broad-scale leaf pest-killing plants to be true test. California Agriculture 52:14-20. 28. Fischhoff, D.A., Bowdish, K.S., Perlak, F.J., Marrone, P.G., MvCormick, Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………61 S.M., Niedermeyer, J.G., Dean, D.A., Kusano-Kretzmer, K., Mayer, E.J., Rochester, D.E., Rogers, S.G. and Fraley, R.T. (1987). Insect tolerant tomatoplants. BioTechnology 5:807-812. 29. Gill, S.S., Cowles, E.A. and Pietrantonio, F.V. (1992). The mode of action of Bacillus thuringiensis endotoxins. Annual Review of Entomology 37:615-636 30. Girard, C., Le-Metayer, M., Zaccomer, B., Bartlet, E.,Williams, I., Bonade-Bottino, M., Pham-Delegue, M.H. and Ouanin, L. (1998). Growth stimulation of beetle larvae reared on a transgenic oilseed rape expressing a cysteine proteinase inhibitor. Journal of Insect Physiology 44:263-270. 31. Hannay CL (1953) Crystalline inclusions in aerobic spore-forming bacteria. Nature (Lond),172: 1004. 32. Höfte H & Whiteley HR (1989) Insecticidal crystal proteins of Bacillus thuringiensis. Microbiol Rev, 53: 242-255. 33. Hoftey, H. and Whiteley, H.R. (1989). Insecticidal crystal proteins of Bacillus thuringiensis. Microbiology Review 53:242-255. 34. Knowles, B.H. (1994). Mechanism of action of Bacillus thuringiensis insecticidal δ-endotoxins. Advances in Insect Physiology 24:275-308. 35. Knowles, B.H. and Dow, J.A.T. (1993). The crystalendotoxin of Bacillus thuringiensis: Models for their mechanism of action on the insect gut. Bioassays 15:469. 36. Kota, M., Daniell, H., Varma, S., Garczynski, S.F., Gould, F. and Moar, W.J. (1999). Overexpression of the (Bt) Cry2Aa2 protein in chloroplasts confers resistance to plants against susceptible and Bt- resistant insects. Proceedings of the National Academy of Sciences USA 96:840-1845. Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………62 37. Lee, M.K., Milne, R.E., Ge, A.Z. and Dean, D.H. (1992). Location of Bombyx mori binding receptor on Bacillus thuringiensis delta endotoxin. Journal of Biological Chemistry 267:3115-3121. 38. McLaren, J.S. (1998). The success of transgenic crops in the USA. Pesticide Outlook 9:36-41. 39. Milne, R. and Kaplan, H. (1993). Purification and characterisation of a trypsin like digestive enzyme from spruce budworm (Christoneura fumiferana) responsible for the activation of δ-endotoxin from Bacillus thuringiensis. Insect Biochemistry and Molecular Biology 23:663-673. 40. Perlak, F.J., Stone, T.B., Muskopf, Y.N., Petersen, L.J.,Parker, G.B., McPherson, S.A., Wyman, J., Love, S., Reed,G., Biever, D. and Fischhoff, D.A. (1993). Genetically improved potatoes: protection from damage by Colorado potato beetles. Plant Molecular Biology 22:313-321. 41. Reed S. M. 1993: Use of stomatal size to distinguish between haploid and dihaploid tobacco plants. Tobbaco Sciences 37: 84-86. 42. Riba G. et Silvy C 1992: Combattre les ravageurs des cultures: Enjeux et perspectives. Institute National de la Recherche Agronomique. Paris. 43. Schnepf, H.E. and Whitley, H.R. (1981). Cloning and expression of Bacillus thuringinesis crystal protein gene in Escherichia coli. Proceedings of the National Academy of Sciences USA 78:2893-2897. 44. Steinhaus, E.A. (1951). Possible use of Bacillusthuringiensis Berliner as an aid in the biological control of the alfalfa caterpillar. Hilgardia 20:350-381. 45. Svab, Z. and Maliga, P. (1993). High frequency plastid transformation in tobacco by selection for an acd A gene. Proceedings of National Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………63 Academy of Sciences USA 90:913-917. 46. Tojo, A. and Aizawa, K. (1983). Dissolution and degradation of δ- endotoxin by gut juice protease of silkworm, Bombyx mori. Applied and Environmental Microbiology 45:576-580. 47. Tso, T. C. 1990: Production, Physiology and Biochemistry of Tobacco Plant. IDEALS, Inc. USA. 753 p. 48. Universsal leaf tobacco company, INC 2008 supply and demand report 49. Warren, G.W. (1997) Vegetative insecticidal proteins: novel proteins for control of corn pests. In Advances in Insect Control, the Role of Transgenic Plants ed. Carozzi, N.B. and Koziel, M. pp. 109-121. London: Taylors & Francis Ltd. 50. Yu, C.-G., M. A. Mullins, G. W. Warren, M. G. Koziel, and J. J. Estruch. 1997. The Bacillus thuringiensis vegetative insecticidal protein Vip3A lyses midgut epithelium cells of susceptible insects. Applied and Environmental Microbiology 63:532-536 C. CÁC TRANG ðIỆN TỬ 51. Báo cáo tóm tắt số 39-2008 của ISAAA, Hiện trạng cây trồng CNSH/cây trồng chuyển gen trên toàn cầu năm 2008. 52. 53. 11174 Cần có quy chế cụ thể cho cây trồng chuyển gen ở Việt Nam 54. 55. 56. 57. 58. Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………64 PHỤ LỤC Phụ lục 1: Thành phần môi trường MS (Murashige và Skoog, 1962) Nhóm Hóa chất Hàm lượng (mg/l) KNO3 1900 NH4NO3 1650 MgSO4 180,54 KH2PO4 170 ða lượng CaCl2 332,02 H3BO3 6,2 MnSO4 22,3 ZnSO4 8,6 KI 0,83 Na2MoO4 0,25 CuSO4 0,025 CoCl2 0,025 Na2EDTA 37,3 Vi lượng FeSO4.7H2O 27,8 Glysin 2 Nicotinic acid 0,5 Myo-Inositol 100 Pyridoxine HCl 0,5 Vitamin Thiamine HCl 0,1 Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………65 Phụ lục 2: TRÌNH TỰ GEN vip3A LOCUS AJ971413 2370 bp DNA linear BCT 19- MAY-2005 DEFINITION Bacillus thuringiensis vip3A gene for vegetative insecticidal protein. ACCESSION AJ971413 VERSION AJ971413.1 GI:66351675 KEYWORDS vegetative insecticidal protein; vip3A gene. SOURCE Bacillus thuringiensis ORGANISM Bacillus thuringiensis Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus; Bacillus cereus group. REFERENCE 1 AUTHORS Pham,N.B., Le,N.H., Pham,T.T., Chu,H.H. and Le,B.T. TITLE Cloning and sequence analysis gene encoding the vegetative insecticidal protein (VIP3A) of some Vietnamese B. thuringiensis strains JOURNAL Unpublished REFERENCE 2 (bases 1 to 2370) AUTHORS Pham,N.B. TITLE Direct Submission JOURNAL Submitted (19-MAY-2005) Pham N.B., Plant Cell Technology, Institute of Biotechnology (IBT), Hoang Quoc Viet Str. 18, Cau Giay, Hanoi,10000, VIET NAM FEATURES Location/Qualifiers source 1..2370 /organism="Bacillus thuringiensis" /mol_type="genomic DNA" /strain="BTAB51" /db_xref="taxon:1428" /country="Viet Nam" gene 1..2370 /gene="vip3A" CDS 1..2370 /gene="vip3A" /codon_start=1 /transl_table=11 /product="vegetative insecticidal protein" /protein_id="CAI96522.1" /db_xref="GI:66351676" /db_xref="GOA:Q4VYT0" /db_xref="InterPro:IPR003305" /db_xref="InterPro:IPR008927" /db_xref="InterPro:IPR008979" /db_xref="UniProtKB/TrEMBL:Q4VYT0" /translation="MNKNNTKLSTRALPSFIDYFNGIYGFATGIKDIMNMIFKTDTGG DLTLDEILKNQQLLNDISGKLDGVNGSLNDLIAQGNLNTELSKEILKIANEQNQVLND VNNKLDAINTMLRVYLPKITSMLSDVMKQNYALSLQIEYLSKQLQEISDKLDIINVNV LINSTLTEITPAYQRIKYVNEKFEELTFATETSSKVKKDGSPADILDELTELTELAKS VTKNDVDGFEFYLNTFHDVMVGNNLFGRSALKTASELITKENVKTSGSEVGNVYNFLI Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………66 VLTALQAKAFLTLTTCRKLLGLADIDYTSIMNEHLNKEKEEFRVNILPTLSNTFSNPN YAKVKGSDEDAKMIVEAKPGHALIGFEISNDSITVLKVYEAKLKQNYQVDKDSLSEVI YGDMDKLLCPDQSEQIYYTNNIVFPNEYVITKIDFTKKMKTLRYEVTANFYDSSTGEI GLNKKKVESSEAEYRTLSANDDGVYMPLGVISETFLTPINGFGLQADENSRLITLTCK SYLRELLLATDLSNKETKLIVPPSGFISNIVENGSIEEDNLEPWKANNKNAYVDHTGG VNGTKALYVHKDGGISQFIGDKLKPKTEYVIQYTVKGKPSIHLKDENTGYIHYEDTNN NLEDYQTINKRFTTGTDLKGVYLILKSQNGDEAWGDNFIILEISPSEKLLSPELINTN NWTSTGSTNISGNTLTLYQGGRGILKQNLQLDSFSTYRVYFSVSGDANVRIRNSREVL FEKRYMSGAKDVSEMFTTKFEKDNFYIELSQGNNLYGGPIVHFYDVSIK" ORIGIN 1 atgaacaaga ataatactaa attaagcaca agagccttac caagttttat tgattatttt 61 aatggcattt atggatttgc cactggtatc aaagacatta tgaacatgat ttttaaaacg 121 gatacaggtg gtgatctaac cctagacgaa attttaaaga atcagcagtt actaaatgat 181 atttctggta aattggatgg ggtgaatgga agcttaaatg atcttatcgc acagggaaac 241 ttaaatacag aattatctaa ggaaatatta aaaattgcaa atgaacaaaa tcaagtttta 301 aatgatgtta ataacaaact cgatgcgata aatacgatgc ttcgggtata tctacctaaa 361 attacctcta tgttgagtga tgtaatgaaa caaaattatg cgctaagtct gcaaatagaa 421 tacttaagta aacaattgca agagatttct gataagttgg atattattaa tgtaaatgta 481 cttattaact ctacacttac tgaaattaca cctgcgtatc aaaggattaa atatgtgaac 541 gaaaaatttg aggaattaac ttttgctaca gaaactagtt caaaagtaaa aaaggatggc 601 tctcctgcag atattcttga tgagttaact gagttaactg aactagcgaa aagtgtaaca 661 aaaaatgatg tggatggttt tgaattttac cttaatacat tccacgatgt aatggtagga 721 aataatttat tcgggcgttc agctttaaaa actgcatcgg aattaattac taaagaaaat 781 gtgaaaacaa gtggcagtga ggtcggaaat gtttataact tcttaattgt attaacagct 841 ctgcaagcaa aagcttttct tactttaaca acatgccgaa aattattagg cttagcagat 901 attgattata cttctattat gaatgaacat ttaaataagg aaaaagagga atttagagta 961 aacatcctcc ctacactttc taatactttt tctaatccta attatgcaaa agttaaagga 1021 agtgatgaag atgcaaagat gattgtggaa gctaaaccag gacatgcatt gattgggttt 1081 gaaattagta atgattcaat tacagtatta aaagtatatg aggctaagct aaaacaaaat 1141 tatcaagtcg ataaggattc cttatcggaa gttatttatg gtgatatgga taaattattg 1201 tgcccagatc aatctgaaca aatctattat acaaataaca tagtatttcc aaatgaatat 1261 gtaattacta aaattgattt cactaaaaaa atgaaaactt taagatatga ggtaacagcg 1321 aatttttatg attcttctac aggagaaatt ggcttaaata agaaaaaagt agaatcaagt 1381 gaagcggagt atagaacgtt aagtgctaat gatgatgggg tgtatatgcc gttaggtgtc 1441 atcagtgaaa catttttgac tccgattaat gggtttggcc tccaagctga tgaaaattca 1501 agattaatta ctttaacatg taaatcatat ttaagagaac tactgctagc aacagactta 1561 agcaataaag aaactaaatt gatcgtcccg ccaagtggtt ttattagcaa tattgtagag 1621 aacgggtcca tagaagagga caatttagag ccgtggaaag caaataataa gaatgcgtat 1681 gtagatcata caggcggagt gaatggaact aaagctttat atgttcataa ggacggagga 1741 atttcacaat ttattggaga taagttaaaa ccgaaaactg agtatgtaat ccaatatact 1801 gttaaaggaa aaccttctat tcatttaaaa gatgaaaata ctggatatat tcattatgaa 1861 gatacaaata ataatttaga agattatcaa actattaata aacgttttac tacaggaact 1921 gatttaaagg gagtgtattt aattttaaaa agtcaaaatg gagatgaagc ttggggagat 1981 aactttatta ttttggaaat tagtccttct gaaaagttat taagtccaga attaattaat 2041 acaaataatt ggacgagtac gggatcaact aatattagcg gtaatacact cactctttat 2101 cagggaggac gagggattct aaaacaaaac cttcaattag atagtttttc aacttataga 2161 gtgtattttt ctgtgtccgg agatgctaat gtaaggatta gaaattctag ggaagtgtta 2221 tttgaaaaaa gatatatgag cggtgctaaa gatgtttctg aaatgttcac tacaaaattt 2281 gagaaagata acttttatat agagctttct caagggaata atttatatgg tggtcctatt 2341 gtacattttt acgatgtctc tattaagtaa // Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………67 Phụ lục 3: CẤU TRÚC VECTOR pBI121 Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………68 Phụ lục 4: Phương pháp chuyển gen quan tâm vào cây thuốc lá (cải tiến) (Topping, 1998) TT các bước Nội dung thực hiện 1 Cấy ria vạch khuẩn lạc ra ñĩa có chứa LB ñặc có bổ sung kháng sinh chọn lọc. Ủ trong 28oC trong 2 ngày 2 Chuẩn bị mảnh cấy thuốc lá bằng cách cắt các mảnh lá thành các mẫu có kích thước khoảng 1 cm2, ñặc trên môi trường GM trong 2 ngày 3 Một ngày trước khi biến nạp, nuôi một khuẩn lạc vào 2ml LB lỏng có bổ sung kháng sinh chọn lọc, nuôi qua ñêm (16 -20 giờ) 4 Biến nạp: - Khuẩn sau khi nuôi qua ñêm ñược ñem ño OD660= 0,5 – 1 thì sử dụng ñể biến nạp - Các mảnh lá sau 2 ngày nuôi cảm ứng trên môi trường GM ñược chuyển sang ñĩa petri có chứa 5 ml dung dịch MS lỏng - ðổ dịch khuẩn vào ñĩa petri có chứa mảnh lá ở trên 5 Sau 10 phút chuyển các mảnh lá lên giấy thấm tiệt trùng, thấm khô và cấy lên môi trường GM không có kháng sinh, ñồng nuôi cấy 02 ngày 6 Sau 02 ngày, cấy chuyển các mảnh lá sang môi trường GM có bổ sung Cefotaxim 400 mg/l + Kanamycine 30 mg/l 7 Sau 2 – 3tuần các chồi hình thành ñược cắt và cấy chuyển sang môi trường GM có bổ sung kháng sinh Cefotaxim 400 mg/l + Kanamycine 50 mg/l 8 Các chồi dài 2-3 cm thì ñược cắt và cấy chuyển sang môi trường ra rễ RM có bổ sung kháng sinh Cefotaxim 400 mg/l + Kanamycine 50 mg/l 9 Các cây con cao 5 -7 cm thì ñược cắt và chuyển sang môi trường ra rễ RM có bổ sung kháng sinh Cefotaxim 400 mg/l + Kanamycine 50 mg/l mới 10 Cây con ra rễ nhiều , cao 5 -7 cm thì ñược ñưa ra bầu chứa giá thể trấu : cát (1:1) 11 Sau 7 -14 ngày trồng cây ra bầu ñất trong nhà kính 12 Tiến hành các nội dung kiểm tra cây sau chuyển gen 13 Thu hạt ñể phân tích các thế hệ sau Chú ý: Tất cả các bước ñều có kèm công thức ñối chứng Ghi chú: thành phần các loại môi trường Môi trường Thành phần GM (Tái sinh) MS + BAP 1mg/l + Sucrose 30 g/l + agar 9 g/l, pH = 5,8 RM (Ra rễ) MS + IBA 0,1mg/l + Sucrose 30 g/l + agar 9 g/l, pH = 5,8 LB lỏng Bacto pepton 10 g/l + Nacl 10 g/l + Yeast Extract 5 g/l, pH = 7 LB ñặc LB lỏng + agar 16g/l Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………69 Phụ lục 5: XỬ LÝ SỐ LIỆU BALANCED ANOVA FOR VARIATE TLML FILE HAOLV 16/ 9/ 9 10:33 ------------------------------------------------------------------ :PAGE 1 Thi nghiem bo tri hoan toan ngau nhien TLMM: ty le manh la TLCC: ty le cum choi TLRR1: ty le ra re chon loc lan 1 TLRR2: ty le ra re chon loc lan 2 VARIATE V003 TLML LE LN SOURCE OF VARIATION DF SUMS OF MEAN F RATIO PROB ER SQUARES SQUARES LN ============================================================================= 1 CT$ 2 14988.7 7494.33 613.17 0.000 2 * RESIDUAL 6 73.3340 12.2223 ----------------------------------------------------------------------------- * TOTAL (CORRECTED) 8 15062.0 1882.75 ----------------------------------------------------------------------------- BALANCED ANOVA FOR VARIATE TLCC FILE HAOLV 16/ 9/ 9 10:33 ------------------------------------------------------------------ :PAGE 2 Thi nghiem bo tri hoan toan ngau nhien TLMM: ty le manh la TLCC: ty le cum choi TLRR1: ty le ra re chon loc lan 1 TLRR2: ty le ra re chon loc lan 2 VARIATE V004 TLCC LN SOURCE OF VARIATION DF SUMS OF MEAN F RATIO PROB ER SQUARES SQUARES LN ============================================================================= 1 CT$ 2 16328.7 8164.33 ****** 0.000 2 * RESIDUAL 6 17.3320 2.88867 ----------------------------------------------------------------------------- * TOTAL (CORRECTED) 8 16346.0 2043.25 ----------------------------------------------------------------------------- BALANCED ANOVA FOR VARIATE TLRR1 FILE HAOLV 16/ 9/ 9 10:33 ------------------------------------------------------------------ :PAGE 3 Thi nghiem bo tri hoan toan ngau nhien TLMM: ty le manh la TLCC: ty le cum choi TLRR1: ty le ra re chon loc lan 1 TLRR2: ty le ra re chon loc lan 2 VARIATE V005 TLRR1 LN SOURCE OF VARIATION DF SUMS OF MEAN F RATIO PROB ER SQUARES SQUARES LN ============================================================================= 1 CT$ 2 15266.7 7633.33 ****** 0.000 2 * RESIDUAL 6 31.3339 5.22231 ----------------------------------------------------------------------------- * TOTAL (CORRECTED) 8 15298.0 1912.25 ----------------------------------------------------------------------------- BALANCED ANOVA FOR VARIATE TLRR2 FILE HAOLV 16/ 9/ 9 10:33 ------------------------------------------------------------------ :PAGE 4 Thi nghiem bo tri hoan toan ngau nhien Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………70 TLMM: ty le manh la TLCC: ty le cum choi TLRR1: ty le ra re chon loc lan 1 TLRR2: ty le ra re chon loc lan 2 VARIATE V006 TLRR2 LN SOURCE OF VARIATION DF SUMS OF MEAN F RATIO PROB ER SQUARES SQUARES LN ============================================================================= 1 CT$ 2 16234.4 8117.21 ****** 0.000 2 * RESIDUAL 6 36.0269 6.00448 ----------------------------------------------------------------------------- * TOTAL (CORRECTED) 8 16270.4 2033.81 ----------------------------------------------------------------------------- TABLE OF MEANS FOR FACTORIAL EFFECTS FILE HAOLV 16/ 9/ 9 10:33 ------------------------------------------------------------------ :PAGE 5 Thi nghiem bo tri hoan toan ngau nhien TLMM: ty le manh la TLCC: ty le cum choi TLRR1: ty le ra re chon loc lan 1 TLRR2: ty le ra re chon loc lan 2 MEANS FOR EFFECT CT$ ------------------------------------------------------------------------------- CT$ NOS TLML TLCC TLRR1 TLRR2 CTTN 3 77.6667 82.3333 73.3333 81.8000 DC1 3 0.000000 0.000000 0.000000 0.000000 DC2 3 93.3333 96.6667 96.6667 96.5667 SE(N= 3) 2.01844 0.981270 1.31938 1.41474 D.F. 0 6.00000 6.00000 6.00000 6.00000 5%LSD 0 6.98211 3.39437 4.56395 4.89382 ------------------------------------------------------------------------------- ANALYSIS OF VARIANCE SUMMARY TABLE FILE HAOLV 16/ 9/ 9 10:33 ------------------------------------------------------------------ :PAGE 6 Thi nghiem bo tri hoan toan ngau nhien TLMM: ty le manh la TLCC: ty le cum choi TLRR1: ty le ra re chon loc lan 1 TLRR2: ty le ra re chon loc lan 2 F-PROBABLIITY VALUES FOR EACH EFFECT IN THE MODEL. SECTION - 1 VARIATE GRAND MEAN STANDARD DEVIATION C OF V |CT$ | (N= 9) -------------------- SD/MEAN | | NO. BASED ON BASED ON % | | OBS. TOTAL SS RESID SS | | TLML 9 57.000 43.391 3.4960 6.1 0.0000 TLCC 9 59.667 45.202 1.6996 2.8 0.0000 TLRR1 9 56.667 43.729 2.2852 4.0 0.0000 TLRR2 9 59.456 45.098 2.4504 4.1 0.0000 Trường ðại học Nông nghiệp Hà Nội – Luận văn thạc sỹ khoa học Nông nghiệp ………………………i

Các file đính kèm theo tài liệu này:

  • pdfLuận văn thạc sỹ nông nghiệp nghiên cứu tạo cây thuốc lá chuyên gen kháng sâu.pdf
Luận văn liên quan