Nghiên cứu giải mã vùng gen vp1 của một số mẫu vacxin viêm gan vịt hiện đang sử dụng tại Việt Nam

NGHIÊN CỨU GIẢI MÃ VÙNG GEN VP1 CỦA MỘT SỐ MẪU VACXIN VIÊM GAN VỊT HIỆN ĐANG SỬ DỤNG TẠI VIỆT NAM STUDY ON GENETIC PROPERTIES OF THE ANTIGENIC VP1 GENE OF THE TWO ATTENUATED VACCINE VIRUS SAMPLES OF DUCK HEPATITIS CURRENTLY USED IN VIETNAM SVTH: NGUYỄN THỊ DIỄM QUỲNH Lớp: 03 SH, Trường Đại học Bách khoa GVHD: PGS. TS. LÊ THANH HÒA Phòng Miễn dịch học-Viện Công nghệ Sinh học-Viện Khoa học và Công nghệ Việt Nam TÓM TẮT Viêm gan vịt là một bệnh truyền nhiễm xảy ra ở thể cấp tính đối với vịt con. Trong hệ gen của virus viêm gan vịt, gen kháng nguyên VP1 - vừa quyết định tính kháng nguyên, vừa quyết tính độc lực của virus. Trong đề tài này, toàn bộ gen VP1 có độ dài 714 bp đã được thu nhận từ hai chủng vacxin nghiên cứu: i) chủng vacxin xưởng thuốc (kí hiệu là VxXT), ii) chủng vacxin Ai Cập (kí hiệu là VxAC). Với chương trình BLAST, tiến hành truy cập Ngân hàng gen sử dụng chuỗi gen kháng nguyên VP1 của hai mẫu nghiên cứu trên, chúng tôi nhận thấy rằng gen VP1 của mẫu VxAC có độ tương đồng cao với các chủng virus viêm gan vịt type 1 (DHV1) của thế giới. Bằng phương pháp phân tích phả hệ cho thấy: Chủng vacxin Ai Cập có thể có nguồn gốc từ Trung Quốc, còn chủng vacxin xưởng thuốc mặc dù vẫn nằm trong nhánh các chủng của Trung Quốc nhưng có quan hệ xa hơn so với chủng vacxin Ai Câp, và có thể có nguồn gốc từ một chủng cổ điển của Hàn Quốc. ABSTRACT Duck hepatitis virus (DHV) is an acute and fatal disease of young ducklings characterized by its rapid transmission. In the genome of Duck hepatitis virus type 1 (DHV1), the VP1 antigenic gene affects to the antigenic and virulent of hepatitis virus. The complete 714 bp VP1 sequence was obtained from the two samples of attenuated vaccine: i) a vaccine strain from VETVACO (designated as VxXT); ii) a vaccine strain from Egypt (designated as VxAC) strains (Egyptian vaccine). Using the VP1 sequence of each strain as an entry to search at BLAST, it revealed that our VP1 of VxAC has high identity to DHV1 of world strains. Phylogenetic analysis confirmed the Chinese origin of VxAC and Korean origin of VxXT. The VxXT strain, although belongs to the group of other Chinese strains, has more distant relation than the Egyptian vaccine (VxAC) strain, possibly it has been originated from a classical strain of Korea.

pdf5 trang | Chia sẻ: lvcdongnoi | Ngày: 12/01/2013 | Lượt xem: 1827 | Lượt tải: 2download
Bạn đang xem nội dung tài liệu Nghiên cứu giải mã vùng gen vp1 của một số mẫu vacxin viêm gan vịt hiện đang sử dụng tại Việt Nam, để tải tài liệu về máy bạn click vào nút DOWNLOAD ở trên
Tuyển tập Báo cáo “Hội nghị Sinh viên Nghiên cứu Khoa học” lần thứ 6 Đại học Đà Nẵng - 2008 242 NGHIÊN CỨU GIẢI MÃ VÙNG GEN VP1 CỦA MỘT SỐ MẪU VACXIN VIÊM GAN VỊT HIỆN ĐANG SỬ DỤNG TẠI VIỆT NAM STUDY ON GENETIC PROPERTIES OF THE ANTIGENIC VP1 GENE OF THE TWO ATTENUATED VACCINE VIRUS SAMPLES OF DUCK HEPATITIS CURRENTLY USED IN VIETNAM SVTH: NGUYỄN THỊ DIỄM QUỲNH Lớp: 03 SH, Trường Đại học Bách khoa GVHD: PGS. TS. LÊ THANH HÒA Phòng Miễn dịch học-Viện Công nghệ Sinh học-Viện Khoa học và Công nghệ Việt Nam TÓM TẮT Viêm gan vịt là một bệnh truyền nhiễm xảy ra ở thể cấp tính đối với vịt con. Trong hệ gen của virus viêm gan vịt, gen kháng nguyên VP1 - vừa quyết định tính kháng nguyên, vừa quyết tính độc lực của virus. Trong đề tài này, toàn bộ gen VP1 có độ dài 714 bp đã được thu nhận từ hai chủng vacxin nghiên cứu: i) chủng vacxin xưởng thuốc (kí hiệu là VxXT), ii) chủng vacxin Ai Cập (kí hiệu là VxAC). Với chương trình BLAST, tiến hành truy cập Ngân hàng gen sử dụng chuỗi gen kháng nguyên VP1 của hai mẫu nghiên cứu trên, chúng tôi nhận thấy rằng gen VP1 của mẫu VxAC có độ tương đồng cao với các chủng virus viêm gan vịt type 1 (DHV1) của thế giới. Bằng phương pháp phân tích phả hệ cho thấy: Chủng vacxin Ai Cập có thể có nguồn gốc từ Trung Quốc, còn chủng vacxin xưởng thuốc mặc dù vẫn nằm trong nhánh các chủng của Trung Quốc nhưng có quan hệ xa hơn so với chủng vacxin Ai Câp, và có thể có nguồn gốc từ một chủng cổ điển của Hàn Quốc. ABSTRACT Duck hepatitis virus (DHV) is an acute and fatal disease of young ducklings characterized by its rapid transmission. In the genome of Duck hepatitis virus type 1 (DHV1), the VP1 antigenic gene affects to the antigenic and virulent of hepatitis virus. The complete 714 bp VP1 sequence was obtained from the two samples of attenuated vaccine: i) a vaccine strain from VETVACO (designated as VxXT); ii) a vaccine strain from Egypt (designated as VxAC) strains (Egyptian vaccine). Using the VP1 sequence of each strain as an entry to search at BLAST, it revealed that our VP1 of VxAC has high identity to DHV1 of world strains. Phylogenetic analysis confirmed the Chinese origin of VxAC and Korean origin of VxXT. The VxXT strain, although belongs to the group of other Chinese strains, has more distant relation than the Egyptian vaccine (VxAC) strain, possibly it has been originated from a classical strain of Korea. 1. ĐẶT VẤN ĐỀ Bệnh viêm gan vịt do virus (duck hepatitis virus-DHV) là một bệnh truyền nhiễm xảy ra ở thể cấp tính với vịt con 1-6 tuần tuổi (Woolcock, 2003) [5], bệnh lây lan nhanh và gây tỉ lệ chết rất cao, có khi lên đến 100% trên toàn đàn. Hệ gen của virus viêm gan vịt chứa axit ribonucleic (ARN). Trong hệ gen của virus viêm gan vịt, thì vùng được quan tâm nhiều nhất là vùng gen mã hoá cho protein cấu trúc VP1. Vùng gen này đã được chứng minh là gen kháng nguyên, nó vừa quyết định tính kháng nguyên vừa quyết định tính gây bệnh của virus (Mulder và cs, 2000), (Oberste và cs, 1999), (Santti và cs, 2000) [1], [2], [3]. Để phòng và trị bệnh viêm gan vịt, ở nước ta đang sử dụng một số loại vacxin nhược độc và vô hoạt, nhưng hiệu quả vẫn còn nhiều hạn chế. Mặc khác, hiện nay ở nước ta vẫn chưa có một nghiên cứu nào về sinh học phân tử gen kháng nguyên VP1 và hệ gen virus viêm gan vịt. Từ thực tế đó, để cung cấp nguồn gen virus viêm gan vịt trong ngân hàng gen của nước ta, đồng thời góp phần xác định chính xác khả năng bảo hộ của vacxin đang sử dụng hiện nay, chúng tôi tiến hành thực hiện đề tài: “Nghiên cứu giải mã vùng gen VP1 của một số mẫu vacxin viêm gan vịt hiện đang được sử dụng tại Việt Nam”. Tuyển tập Báo cáo “Hội nghị Sinh viên Nghiên cứu Khoa học” lần thứ 6 Đại học Đà Nẵng - 2008 243 2. TỔNG QUAN Hệ gen của virus viêm gan vịt bao gồm khoảng 7690 nucleotit, chứa duy nhất một khung đọc mở, mã hoá cho một chuỗi protein duy nhất, chuỗi protein này sau khi được tạo ra, sẽ trải qua nhiều lần phân cắt để tạo các protein sản phẩm độc lập (Tseng và cs., 2007) [4]. Nằm ở đầu 5’ có vùng gen không mã hoá gọi là 5’UTR, nằm ở đầu 3’ cũng có vùng gen không mã hoá gọi là 3’UTR, và đuôi poly (A) ở cuối. Giữa hai vùng không mã hoá 5’UTR và 3’UTR là vùng gen mã hoá tổng hợp protein. Vùng này bao gồm ba tổ hợp gen: tổ hợp gen P1 mã hoá cho ba loại protein cấu trúc là VP0, VP3 và VP1; tiếp theo là tổ hợp gen P2 mã hoá cho các protein không cấu trúc là 2A, 2B, 2C; nằm cuối cùng là tổ hợp gen P3 mã hoá cho các loại protein không cấu trúc là 3A, 3B, 3C, 3D (Hình 2.1). Hình 2.1. Sơ đồ hệ gen virus viêm gan vit type (Tseng và cs., 2007)[4] Trong hệ gen virus viêm gan vịt thì vùng gen được quan tâm nghiên cứu nhiều nhất là gen mã hoá cho protein VP1.Vùng gen này bao gồm 714 nucleotit. Gen này đã được chứng minh là gen kháng nguyên, nó quyết định tính kháng nguyên và tính độc lực của virus. Những sai khác trong vùng gen này rất dễ dẫn đến thay đổi tính kháng nguyên và tính độc lực của virus viêm gan vịt. 3. NGUYÊN LIỆU VÀ PHƯƠNG PHÁP NGHIÊN CỨU 3.1. Nguyên liệu  Chủng vacxin viêm gan vịt nhược độc do Xí nghiệp thuốc Thú y Trung ương sản xuất (kí hiệu: VxXT)  Chủng vacxin viêm gan vịt nhược độc của Ai Cập do Trường Đại học Nông nghiệp I Hà Nội cung cấp (kí hiệu: VxAC) 3.2. Phương pháp nghiên cứu: Sử dụng các phương pháp sinh học phân tử như: phương pháp tách chiết ARN tổng số, phương pháp RT-PCR, phương pháp điện di, phương pháp dòng hóa, phương pháp giải trình trình tự. 4. KẾT QUẢ VÀ THẢO LUẬN 4.1. Kết quả thực hiện phản ứng RT-PCR ARN tổng số được tách chiết, dùng làm khuôn để thực hiện phản ứng RT-PCR, sử dụng hai đoạn mồi DH3F và DH4R để nhân vùng gen VP1 của hệ gen virus viêm gan vịt.. Đoạn chứa gen VP1 và 2 mồi có độ dài khoảng 800 bp. Sau đó sản phẩm của phản ứng RT- PCR được điện di trên thạch agarose 1% để kiểm tra. Kết quả điện di được thể hiện trên hình 4.1. Trên hình 4.1 cho thấy, có xuất hiện một băng ADN rõ nét, khi so sánh với kích thước các băng của chỉ thị phân tử chúng tôi nhận thấy băng này có kích thước khoảng 800 bp tương ứng với kích thước của sản phẩm RT-PCR dự kiến. Như vậy, có thể kết luận rằng chúng tôi đã thực hiện thành công việc nhân đoạn gen VP1 của virus viêm gan vịt bằng phản ứng RT-PCR. Đồng thời hai đoạn mồi (DH3F và DH4R) cùng những thành phần phản ứng và chu trình nhiệt mà chúng tôi chọn là hoàn toàn phù hợp để nhân vùng gen VP1 trong hệ gen của virus viêm gan vịt. 4.2. Kết quả dòng hoá TỔ HỢP GEN P1 TỔ HỢP GEN P2 TỔ HỢP GEN P3 Tuyển tập Báo cáo “Hội nghị Sinh viên Nghiên cứu Khoa học” lần thứ 6 Đại học Đà Nẵng - 2008 244 Sau khi thực hiện thành công phản ứng RT-PCR , sản phẩm của phản ứng RT-PCR sẽ được tiến hành dòng hoá, tức là nối sản phẩm này vào plasmid vector (pCR2.1 TOPO), plasmid vector mang AND ngoại lai này được gọi là plasmid tái tổ hợp. Sau đó plasmid tái tổ hợp này sẽ được chuyển nạp vào tế bào khả biến E. coliDH5α và được nuôi cấy trên môi trường thích hợp để plasmid tái tổ hợp nhân lên với số lượng lớn. Cuối cùng plasmid tái tổ hợp sẽ được tách chiết bằng bộ kít tách chiết plasmid tái tổ hợp, sản phẩm AND plasmid tái tổ hợp sẽ được cắt với enzim EcoRI rồi điện di trên thạch agarose 1% để kiểm tra xem sản phẩm RT- PCR có được dòng hoá vào plasmid vector hay không. Kết quả điện di được thể hiện ở hình 4.2. Kết quả trên hình 4.2 cho thấy có hai băng sáng trắng ở mỗi lỗ giếng 1, 2 và 3. Khi so sánh với kích thước các băng của chỉ thị phân tử thì chúng tôi nhận thấy: băng nằm ở trên, có kích thước 3,9 kb, tương ứng với kích thước của vector pCR2.1-TOPO, còn băng ở dưới, có kích thước khoảng 800 bp, tương ứng với kích thước của sản phẩm RT-PCR dự kiến. Vì vậy có thể kết luận rằng: chúng tôi đã thành công trong việc dòng hoá sản phẩm RT-PCR của hai mẫu vacxin (VxXT và VxAC), và đưa các đoạn gen này vào lưu giữ trong vector tách dòng. 4.3. Kết quả giải trình trình tự và so sánh trên Ngân hàng Gen Sau khi dòng hoá thành công, chúng tôi tiến hành giải trình trình tự, xử lý chuỗi gen để có được chuỗi gen VP1 hoàn chỉnh của hai mẫu nghiên cứu. Với chương trình BLAST ( chúng tôi tiến hành truy cập Ngân hàng gen sử dụng chuỗi gen kháng nguyên VP1 của hai mẫu nghiên cứu trên, chúng tôi đã thu được một số chủng khác trên thế giới có độ tương đồng cao so với hai chủng nghiên cứu. Trong số các chủng trong Ngân hàng gen, chúng tôi đã chọn ra 8 chủng đại diện để so sánh sự tương đồng về nucleotit và axit amin giữa hai chủng nghiên cứu với các chủng khác trên thế giới, đặc biệt là với các chủng của Châu Á. Kết quả so sánh được thể hiện ở hình 4.3. Để thấy rõ hơn sự tương đồng về nucleotit và axit amin giữa hai chủng nghiên cứu với các chủng khác trên thế giới, chúng tôi tiến hành lập bảng so sánh sự tương đồng về nucleotit và axit amin (%) giữa hai chủng nghiên cứu với các chủng khác trên thế giới. Từ kết quả so sánh sự tương đồng về tỷ lệ %, chúng tôi nhận xét chủng vacxin Ai Cập có độ tương đồng cao (99%) về nucleotit và axit amin so với 3 bp564 M2 1 800 bp Hình 4.1. Kết quả điện di sản phẩm RT-PCR (~800 bp) của mẫu VxXT và VxAC trên thạch agarose 1%. Ghi chú: M: chỉ thị phân tử ADN của thực khuẩn thể Lamda được cắt bằng enzym HindIII, 1: sản phẩm RT-PCR của mẫu VxXT, 2: sản phẩm RT-PCR của mẫu VxAC. 800 bp 3.9 kb 564 bp 4.3 kb 2.0 kb M23 1 Hình 4.2. Kết quả tách dòng vùng gen VP1 của virus viêm gan vịt, và điện di trên thạch agarose 1%, các sản phẩm ADN plasmid được kiểm tra bằng cách cắt với enzym EcoRI. Ghi chú. M: chỉ thị phân tử ADN của thực khuẩn thể Lamda được cắt bằng enzim HindIII; 1,2: ADN plasmid tái tổ hợp của mẫu VxAC; 3: ADN plasmid tái tổ hợp của mẫu VxXT. Tuyển tập Báo cáo “Hội nghị Sinh viên Nghiên cứu Khoa học” lần thứ 6 Đại học Đà Nẵng - 2008 245 chủng thuộc Trung Quốc: DHV1vac-SH, DHV1-FS, DHV1-ZJ. Đối với chủng VxT, so với chủng vacxin Ai Cập thì độ tương đồng về nucleotit và axit amin giữa chủng này với 3 chủng của Trung Quốc kể trên thì thấp hơn (95-96%), nhưng lại có sự tương đồng về nucleotit đến 99% so với chủng DHV-HS, một chủng cổ điển của Hàn Quốc (DQ812094). Giữa hai chủng nghiên cứu (VxAC và VxXT), sự tương đồng này không cao lắm, chỉ chiếm 95%. Bằng phương pháp phân tích phả hệ (hình 4.4), chúng tôi đã rút ra kết luận là: Chủng vacxin Ai Cập có thể có nguồn gốc từ Trung Quốc, còn chủng vacxin xưởng thuốc mặc dù vẫn nằm trong nhánh các chủng của Trung Quốc nhưng có quan hệ xa hơn so với chủng vacxin Ai Câp, và có thể chủng vacxin xưởng thuốc này là có nguồn gốc từ một chủng cổ điển của Hàn Quốc. Hình 4.3. So sánh trình tự nucleotit (A) và axit amin (B) v ùng gen VP1 virus viêm gan vịt của hai chủng nghiên cứu (VxAC và VxXT) với các chủng khác trên thế giới. Ghi chú: Dấu chấm A. So sánh về nucleotit B. So sánh về axit amin * 20 * 40 * 60 * 80 * DHV1-VxAC- : GDSNQLGDDEPVCFLNFETANVPIQGESHTLVKHLFGRQWLVRTVQHDSTVQELDLQVPDRGHASLIRFFAYFSGEIILTIVNNGTTPAMVAH : 93 XT ...............................................A....................L........................ DHV1vac-SH : . : 93 ZJ ....-..............................S...........A.................... ........................ 2 DHV1vac- : . . . : 93 -E53(C .... .............................. ...........A.................... ........................ DHV1 FS(CN : . . . : 93 -SY6(C .... .............................. ...........A.................... ........................ DHV1 ZI07- : . . VL . : 93 - J(CN .... .............................. ...........A...................QL........................ 100 * 120 * 140 * 160 * 180 DHV1-VxAC- : SYSMDDLSSEYAVTAMGGVMIPANSAKNISVPFYSVTPLRPTRPIPGTSEATFGRLFMWTQSGSLSVFMGLKKPALFFPLPAPTSTILSQKSK : 186 XT ......................................................................................TS.R..N DHV1vac-SH : .. . . : 186 ZJ ......................................H...............................................T .RG.N 5 DHV1vac- : P . . : 186 -E53(C ...................................... ................................................ ..... DHV1 FS(CN : . . : 186 -SY6(C ...................................E.. .........A.....................................TS.H..N DHV1 ZI07- : . : 186 - J(CN ...................................... .................................................P.... * 200 * 220 * DHV1-VxAC- : DVIPTLNQSGDEVDCHFCEICSKMKRRWKPRGYFRFCLRLKTLAFELNLEIE : 238 XT .A..............................H....F.............. DHV1vac-SH : . . . : 238 ZJ G ................K.......M.....H.... .............. 7 DHV1vac- : . . : 238 -E53(C . ................................... .............. DHV1 FS(CN : . . : 238 -SY6(C G ........................M.....H.... .............. DHV1 ZI07- : . . : 238 - J(CN . ................................... .............. * 20 * 40 * 60 * 80 * 100 DHV1-VxAC- : GGTGATTCTAACCAGTTGGGGGATGATGAGCCAGTTTGCTTTCTAAATTTTGAGACAGCTAATGTCCCAATACAAGGTGAATCTCACACTCTTGTTAAACAC : 102 DHV1-VxXT- : ........C.......................G...........G..................................................C...... : 102 DHV1vac-SH : ...................................................................................................... : 102 DHV1vac-ZJ : ......A.C...T..C.A.......................C..G......................................................... : 102 DHV1vac-ZJ : ...............C.A.......................C..G......................................................... : 102 DHV1-E53(C : ........C............................................................................................. : 102 DHV1-FS(CN : ...................................................................................................... : 102 DHV1-SY6(C : .................A....................T..C..G.......................G...........G....................T : 102 DHV1-ZI07- : .................A.......................C..G.......................G...........G....................T : 102 DHV1-ZJ(CN : ...................................................................................................... : 102 * 120 * 140 * 160 * 180 * 200 DHV1-VxAC- : CTGTTTGGGAGGCAATGGTTAGTTAGGACTGTGCAACACGATTCAACTGTGCAAGAGTTGGACCTCCAAGTTCCAGACAGAGGACATGCCTCTCTCATTCGG : 204 DHV1-VxXT- : ........................................CC...............C.C......................................C... : 204 DHV1vac-SH : ........................................C............................................................. : 204 DHV1vac-ZJ : ....C.................................T.C..............................C.....T........................ : 204 DHV1vac-ZJ : ......................................T.C..............................C.....T........................ : 204 DHV1-E53(C : ........................................C............................................................. : 204 DHV1-FS(CN : ........................................C......................................................A...... : 204 DHV1-SY6(C : ....................G.................T.C....................................T.....G..............C... : 204 DHV1-ZI07- : ....................G.................T.T..T.................................T.....G.........A....C... : 204 DHV1-ZJ(CN : .........................A..............C...........................................................A. : 204 * 220 * 240 * 260 * 280 * 300 DHV1-VxAC- : TTCTTTGCCTATTTTTCTGGAGAGATCATCCTTACCATTGTTAACAATGGCACTACACCAGCAATGGTAGCACACTCCTATTCTATGGATGACCTCAGTTCA : 306 DHV1-VxXT- : C.............C..............T...........C...................................T........ ...........C.... : 306 DHV1vac-SH : .............................T........................................................................ : 306 DHV1vac-ZJ : .............................T.................C..............G.....G.....T....................... .... : 306 DHV1vac-ZJ : .............................T.................C..............G.....G.....T........................... : 306 DHV1-E53(C : .............................T........................................................................ : 306 DHV1-FS(CN : .............................T........................................................................ : 306 DHV1-SY6(C : ........T...................................T................................T..............T......... : 306 DHV1-ZI07- : ........T...................................T................................T..............T......... : 306 DHV1-ZJ(CN : C............................T..C..T.................................................................. : 306 * 320 * 340 * 360 * 380 * 400 DHV1-VxAC- : GAGTATGCTGTTACAGCAATGGGAGGTGTGATGATTCCTGCTAACAGTGCCAAAAATATTTCTGTACCATTCTACTCTGTAACACCACTCAGGCCAACTCGA : 408 DHV1-VxXT- : .................................................................G..............G..................... : 408 DHV1vac-SH : ...................................................................................................... : 408 DHV1vac-ZJ : ...................................C.....C..T..............C....................G.......A............. : 408 DHV1vac-ZJ : ...................................C.....C..T..............CC...................G..................... : 408 DHV1-E53(C : ..........................................G........................................................... : 408 DHV1-FS(CN : ...................................................................................................... : 408 DHV1-SY6(C : .......................G.....A..............T..............C...................AG..................... : 408 DHV1-ZI07- : .......................G.....A..............T..............C...................AG.....G............... : 408 DHV1-ZJ(CN : ...................................................................................................... : 408 * 420 * 440 * 460 * 480 * 500 * DHV1-VxAC- : CCAATTCCTGGCACATCAGAGGCAACTTTTGGCAGACTGTTCATGTGGACTCAATCAGGAAGTCTTTCAGTTTTTATGGGTCTCAAAAAGCCAGCTCTCTTC : 510 DHV1-VxXT- : .........................................T............................................................ : 510 DHV1vac-SH : ...................................................................................................... : 510 DHV1vac-ZJ : ...................................G.................................................................. : 510 DHV1vac-ZJ : ...................................G.................................................................. : 510 DHV1-E53(C : ...................................................................................................... : 510 DHV1-FS(CN : ...................................................................................................... : 510 DHV1-SY6(C : ...............G....A.....C........G..A..T....................C.......................G...........T..T : 510 DHV1-ZI07- : ...............G....A.....C........G..A..T....................C.......................G...........T..T : 510 DHV1-ZJ(CN : ...................................................................................................... : 510 520 * 540 * 560 * 580 * 600 * DHV1-VxAC- : TTTCCACTCCCTGCTCCCACCTCCACAATACTATCACAGAAATCCAAAGATGTTATTCCCACATTGAATCAGTCTGGGGATGAAGTAGATTGTCACTTCTGC : 612 DHV1-VxXT- : .................T..........C.TC.....G..G......T....C................................................. : 612 DHV1vac-SH : ...................................................................................................... : 612 DHV1vac-ZJ : ....................T.......C........G.GG......T.G................G..........A........................ : 612 DHV1vac-ZJ : ....................T.......C........G.GG......T.G................G..........A........................ : 612 DHV1-E53(C : ...................................................................................................... : 612 DHV1-FS(CN : ...................................................................................................... : 612 DHV1-SY6(C : ........T...........T.....G.C.TC......C........T.G.........T...................... ....G............... : 612 DHV1-ZI07- : ........T...........T.....G.C.TC......C........T.GC........T..........................G............... : 612 DHV1-ZJ(CN : .................................C............................................................ ........ : 612 620 * 640 * 660 * 680 * 700 * DHV1-VxAC- : GAAATTTGCTCTAAAATGAAGAGGAGGTGGAAGCCAAGAGGGTACTTCAGATTTTGCCTTAGGCTCAAAACACTAGCATTTGAACTCAATCTGGAAATTGAA : 714 DHV1-VxXT- : ........T.................................C..............T............................................ : 714 DHV1vac-SH : ...................................................................................................... : 714 DHV1vac-ZJ : A.......T................T...........A....C...................A.........T..............G....C......... : 714 DHV1vac-ZJ : A.......T................T...........A....C...................A........................G.............. : 714 DHV1-E53(C : ...................................................................................................... : 714 DHV1-FS(CN : ...................................................................................................... : 714 DHV1-SY6(C : ........T................T......A.....G..AC....T..............A....................................... : 714 DHV1-ZI07- : ........T................T......A.....G..AC....T..............A....................................... : 714 DHV1-ZJ(CN : ...................................................................................................... : 714 Tuyển tập Báo cáo “Hội nghị Sinh viên Nghiên cứu Khoa học” lần thứ 6 Đại học Đà Nẵng - 2008 246 (.) biểu thị giống với trình tự nucleotit (axit amin) tương ứng của VP1 của virus viêm gan vịt chủng VxAC. Sự sai khác về nucleotit (axit amin) của các chủng tiếp theo được thể hiện bằng các chữ cái ký hiệu của chúng. Hình 4.4. Cây phả hệ dựa trên mối quan hệ về nucleotit và axit amin của các chủng virus viêm gan vịt Ghi chú: (A): cây phả hệ dựa trên mối quan hệ về nucleotit; (B): cây phả hệ dựa trên mối quan hệ về về axit amin 5. KẾT LUẬN - ARN tổng số trong đó có hệ gen virus đã được tách chiết thành công, cung cấp nguồn khuôn cho phản ứng RT-PCR. - Với cặp mồi DH3F và DH4R, vùng gen VP1 của hai chủng vacxin đã được thu nhận bằng phản ứng RT-PCR, cung cấp nguồn gen cho nghiên cứu về vacxin virus viêm gan vịt đang được sử dụng tại Việt Nam. - Quá trình dòng hoá đã thực hiện thành công đưa đoạn gen VP1 vào lưu giữ trong vector tách dòng, đồng thời giải mã thành công vùng gen VP1 của cả hai chủng virus viêm gan vịt nghiên cứu. - Chủng VxAC được phân lập có độ tương đồng cao so với 3 chủng DHV-1vac-SH, DHV1- FS, DHV1-ZJ của Trung Quốc, nên có thể chủng VxAC mà ta nghiên cứu có nguồn gốc từ Trung Quốc. Còn đối với chủng VxXT có thể có nguồn gốc từ Hàn Quốc, mặc dù vẫn nằm trong nhánh các chủng của Trung Quốc, nhưng nó đã có quan hệ xa hơn so với chủng VxAC. TÀI LIỆU THAM KHẢO [1] Mulders, M. N., Salminen, M., Kalkkinen, N. and Hovi, T. (2000), Molecular epidemiology of coxsackievirus B4 and disclosure of the correct VP1/2Apro cleavage site: evidence for high genomic diversity and long-term endemicity of distinct genotypes, J Gen Virol 81, 803–812. [2] Oberste, M. S., Maher, K., Kennett, M. L., Campbell, J. J., Carpenter, M. S., Schnurr, D. and Pallansch, M. A. (1999a), Molecular epidemiology and genetic diversity of echovirus type 30 (E30): genotypes correlate with temporal dynamics of E30 isolation, J Clin Microbiol 37, 3928–3933. [3] Santti, J., Harvala, H., Kinnunen, L. and Hyypia¨, T. (2000), Molecular epidemiology and evolution of coxsackievirus A9, J Gen Virol 81, 1361–1372. [4] Tseng, C.H., Knowles, N.J., Tsai, H.J., (2007), Molecular analysis of duck 16 Rapid Communication hepatitis virus type 1 indicates that it should be assigned to a new genus, Virus Res 123, 190–203. [5] Woolcock, P.R., (2003). Duck hepatitis. In: Saif, Y.M., Barnes, H.J., Glisson, J.R., Fadly, A.M., McDougald, L.R., Swayne, D.E. (Eds.), Diseases of Poultry, 11th ed. Iowa State Press, Ames, IA, pp. 343–354. DHV1vac-SH(CN)vp1-EF502171 DHV1-FS(CN)-vp1-EU395438 DHV1-ZJ(CN)vp1-EF382778 DHV1-VxAC-vp1 DHV1-E53(CN)vp1-EF151313 DHV1-VxXT-vp1 DHV1vac-ZJ-A2(CN)vp1-EF502172 DHV1vac-ZJ-A(CN)vp1-ABO30521 DHV1-SY6(CN)vp1-EF407862 DHV1-ZI07-3(CN)vp1-EF502170 0.01 VP1 nucleotit DHV1vac-SH(CN)vp1-EF502171 DHV1-E53(CN)vp1-EF151313 DHV1-FS(CN)-vp1-EU395438 DHV1-VxAC-vp1 DHV1-ZJ(CN)vp1-EF382778 DHV1-VxXT-vp1 DHV1vac-ZJ-A2(CN)vp1-EF502172 DHV1vac-ZJ-A(CN)vp1-ABO30521 DHV1-SY6(CN)vp1-EF407862 DHV1-ZI07-3(CN)vp1-EF502170 0.005 VP1 Axit amin (A) (B)

Các file đính kèm theo tài liệu này:

  • pdfNghiên cứu giải mã vùng gen vp1 của một số mẫu vacxin viêm gan vịt hiện đang sử dụng tại việt nam.pdf