Luận án Nghiên cứu ứng dụng vi khuẩn tỉa quang hợp đú xử lý sulfide trong các nguồn nước ô nhiễm

Từ ảnh điện di đồ Hình 3.19 cho thấy: gen pufM khuếch đại được từ các mẫu ao đối chứng và ao thí nghiệm làm giàu và không làm giàu, điều này cho thấy trong cả hai ao thí nghiệm và ao đối chứng đều có mặt nhóm VKTQH ở đáy ao. Tuy nhiên, nhóm này rất đa dạng về chủng loại cũng như về vai trò của chúng trong tự nhiên. Để kiểm chứng vai trò chuyển hóa sulfide trong điều kiện tự nhiên, chúng tôi đã tiến hành khuếch đại gen sqr từ các mẫu trên: kết quả cho thấy ở các ao đối chứng không bổ sung chế phẩm VKTQH với chức năng loại bỏ sulfide thì không khuếch đại được gen sqr, còn ở các ao thí nghiệm có khuếch đại được gen sqr có kích thước khoảng 1,3 kb bằng kích thước của gen sqr khuếch đại từ chủng QN71. Điều này có thể giải thích ao thí nghiệm có mặt nhóm VKTQH có khả năng sử dụng sulfide, trong khi ao đối chứng dù có mặt của VKTQH có khả năng xử lý sulfide nhưng trong điều kiện tự nhiên chúng có mật độ thấp không đáp ứng đủ khả năng tự xử lý sulfide sinh ra, do vậy, có thể nồng độ DNA của VKTQH có trong mẫu bùn ao đối chứng không đủ để khuếch đại được đoạn gen sqr. Đó có thể là lý do không quan sát được gen sqr trong các mẫu khuếch đại từ ao đối chứng. Kết quả bước đầu cho thấy bổ sung chế phẩm VKTQH xuống đáy ao nuôi cá rô phi thâm canh có thể đánh giá được sự tồn tại và thể hiện hoạt tính của chúng bằng phương pháp sinh học phân tử, mở ra khả năng ứng dụng phương pháp phân tử để đánh giá vai trò hoạt động của các chủng VKTQH trong chế phẩm xử lý ao nuôi trồng thủy sản.

pdf164 trang | Chia sẻ: tueminh09 | Lượt xem: 1363 | Lượt tải: 1Freedownload
Bạn đang xem trước 20 trang tài liệu Luận án Nghiên cứu ứng dụng vi khuẩn tỉa quang hợp đú xử lý sulfide trong các nguồn nước ô nhiễm, để xem tài liệu hoàn chỉnh bạn click vào nút DOWNLOAD ở trên
ter strains isolated from photosynthetic sludge for wastewater treatment. J Ferment Bioeng 79: 39-44. 60. Hiraishi A, Shi JL and Kitamura H (1989) Effects of organic nutrient strength on the purple non-sulfur bacterial content and metabolic activity of photosynthetic sludge for wastewater treatment, J. Ferment. Bioeng, 68(4): 269-276. 61. Hoàng Thị Yến, Đỗ Thị Tố Uyên, Trần Văn Nhị (2006) Đặc điểm sinh học của một số chủng vi khuẩn quang hợp tía sử dụng làm thức ăn tươi sống trong nuôi trồng thủy sản. Tạp chí công nghệ sinh học 6(4A): 791 - 800. 62. Hoogewerf GJ, Jung DO, Madigan T (2003) Envidence for limited species diversity of bacteriochlorophyll b - containing purple nonsulfur anoxygenic phototrophs in fresh water haibitats. FEMS. Microbial: 359 - 364. 63. Hurse TJ, Kappler U and Keller J (2008) Using anoxygenic photosynthetic bacteria for the removal of sulfide from waswate in Sulfur metabolism in Phototrophic organisms. 437 - 460. 126 64. Hurse TJ and Keller J (2004a) Reconsidering the use of photosynthetic bacteria for removal of sulfide from wastewater. Biotechnol Bioeng 85: 47-55. 65. Hurse TJ and Keller J (2004b) Performance of a substratum-irradiated photosynthetic biofilm reactor for the removal of sulfide from wastewater. Biotechnol Bioeng 87: 14-23. 66. Hurse TJ and Keller J (2005) Effects of acetate and propionate on the performance of a photosynthetic biofilm reactor for sulfide removal. Biotechnol Bioeng 89: 178-187. 67. Idi A, Md Nor HM, Abdul Wahab FM, Ibrahim Z (2015) Photosynthetic bacteria: an eco- friendly and cheap tool for bioremediation. Environ Sci Biotecnol 14:271 -285. 68. Imhoff JF (1999) The family Ectothiorhodospiraceae. In: Dworkin M (ed) The Prokaryotes: an Evolving Electronic Resource for the Microbiological Community, 3rd edn. Springer, New York (release December 7, 2000). 69. Imhoff JF (2001) The Anoxygenic Phototrophic Purple Bacteria. In: Boon and Garrity (Eds.) Bergey’s manual of Systematic Bacteriology, 2nd Ed., Vol.1, Springer-Verlag. 70. Imhoff JF (2001a) The phototrophic alpha-proteobacteria. In: Dworkin M (ed) The Prokaryotes: an Evolving Electronic Resource for the Microbiological Community, 3rd edn. Springer, New York (release 3.6. 22 June 2001). 71. Imhoff JF (2001b) The phototrophic beta-proteobacteria. In: Dworkin M (ed) The Prokaryotes: an Evolving Electronic Resource for the Microbiological Community, 3rd edn. Springer, New York (release 3.6. 22 June 2001) 72. Imhoff JF (2008). Systematics of anoxygenic phototrophic bacteria. In: Hell R, Dahl C, Knaff DB, Leustek T, editors. Sulfur metabolism in phototrophic organisms. The Netherlands: Springer: 269-287. 73. Imhoff JF, Trueper HG (1989) Purple non-sulfur bacteria (Rhodospirillaceae Pfennig and Trueper 197, 17AL), P: 1438-1680. In: Staley JT; Bryant M P; Pfennig N, and Holt JG. (eds.). Bergey’ manual of Systematic Bacteriology. Vol. 3. Williams and Wilkins. Baltimore. 127 74. Imhoff JF, Truper HG (1992) The genus Rhodospirillumand related genara, p 2141 - 2155, in Staley JT, Bryant MP, Pfennig N, and Hoil JG, the prokaryotes. 2nd edn, vol 1 William and Wilkins. Baltimore. 75. Jouanneau Y, Lebecque S, and Vignais PM. (1984) Ammonium and light effect on nitrogenase activity in nitrogen-limited continuous culture of Rhodopseudomonas capsulata. Role of glutamin synthetase, Arch. Microbiol. 139: 318-328. 76. Kantachote D, Charernjiratrakul W, N Noparatnaraporn, K Oda. (2008) Selection of sulfur oxidizing bacterium for sulfide removal in sulfate rich wastewater to enhance biogas production. Electronic Journal of Biotechnology ISSN: 0717-3458. Vol.11 No.2, Issue of April 15. 77. Kantachote D, Kornochalert N, and Chaiprapat S (2010) The use of purple non sulfur bacterium isolate P1and fermented pineapple extract to treat latex rubber sheet wastewater for possible use as irrigation water. African journal of Microbiology Research. Vol 4(21): 2296 - 2308. 78. Karr EL, Sattley WM, Jung DO, Madigan MT, and Achenbach LA (2003) Remarkable diversity of phototrophic purple bacteria in a permanently frozen Antarctic lake. Appl Environ Microbiol 69: 4910-4914. 79. Kiemer MCB, Black KD, Lussot D, Bullock M, Ezzi I (1995) The effects of chronic and acute exposure to hydrogen sulfide on Atlantic salmon (Salmo salar L.). Aquaculture 135: 311 - 327. 80. Kilburn KH, Warshaw RH (1995) Hydrogen sulfide and reduced-sulfur gases adversely affect neurophysiological functions. Toxicol. Ind. Health 11:185-197. 81. Kim BW and Chang HN (1991) Removal of hydrogen sulfide by Chlorobium thiosulfatophilum in immobilizedcell and sulfur-settling free-cell recycle reactors. Biotechnol Prog 1991: 495-500. 82. Kim BW, Chang HN, Kim IK and Lee KS (1992) Growth kinetics of the photosynthetic bacterium Chlorobium thiosulfatophilum in a fed-batch reactor. Biotechnol Bioeng 40: 583-592. 128 83. Kim BW, Chang KP and Chang HN (1997) Effect of light source on the microbiological desulfurization in a photobioreactor. Bioprocess Eng 17: 343-348. 84. Kim H, JY, Kim SJ, Chung and Xie Q (2002) Long-termoperation of a biofilter for simultaneous removal of H2S andNH3. Air & Waste Management Association 52: 1389-1398. 85. Kim SH, Oh KJ, Moon JH and Kim D (2000). Simultaneous removal of hydrogen sulfide and ammonia using Thiobacillus sp. IW in a three-phase fluidized-bed bioreactor. J. Microbiol. Biotechnol. 10: 419-422. 86. Kim YJ, Kim BW and Chang HN (1996) Desulfurization in a plate-type gas- lift photobioreactor using light emitting diodes. Kor J Chem Eng 13: 606-611 87. Kleiner D, (2000) Ammonium uptake and ammonium excretion by bacteria - a review. Recent Res. Devel. Microbiology 4: 467-479. 88. Klemme JH (1974) Modulation by fumarate of pi-insensitive pyruvate kinase from Rhodopseudomonas capsulata, Arch. Microbiol. 100: 57-63. 89. Klughammer C, Hager C, Padan E, Schütz M, Schreiber U, Shahak Y, Hauska G (1995) Reduction of cytochromes with menaquinol and sulfide in membranes from green sulfur bacteria. Photosyn Res, 43: 27-34 90. Kobayashi HA, Stenstrom M and Mah RA (1983) Use of photosynthetic bacteria for hydrogen sulfide removal from anaerobic waste treatment effluent. Water Res 17: 579-587. 91. Kobayashi M and Kobayashi M (1995) Waste remediation and treatment using anoxygenic phototrophic bacteria.In: Blankenship RE, Madigan MT and Bauer CE (eds) Anoxygenic Photosynthetic Bacteria, p 1269-1282, Vol 2 of Advances in Photosynthesis (Govindjee ed.). Kluwer Academic (now Springer), Dordrecht 92. Kompantseva EI, Komova AV, Novikov AA, Kostrikina NA (2012) Rhodovulum tesquicola sp. nov., a haloalkaliphilic purple non-sulfur bacterium from brackish steppe soda lakes. Int J Syst Evol Microbiol. 62(Pt 12): 2962-2966. 129 93. Kondratieva EN, and Gogotov IN (1981) Molecular hydrogen in microbial metabolism. Nauka, Moscow: 343. 94. Koblížek M (2011) Role of Photoheterotrophic Bacteria in the Marine Carbon Cycle. In: Jiao N, Azam F, Sanders S, editors. Microbial Carbon Pump in the Ocean. Science/AAAS, Washington D.C. pp. 49-51 95. Lahav O, Ritvo G, Slijper I, Hearne G, Cochva M (2004) The potential of using iron-oxide-rich soils for minimizing the detrimental effects of H2S in freshwater aquaculture systems. Aquaculture, 238 (1-4): 263 - 281. 96. Lakshmi KV, Sasikala C, Ramana VV, Ramaprasad EV, Ramana CV (2011) Rhodovulum phaeolacus sp. nov. a phototrophic alphaproteobacterium isolated from a brown pond. J Gen Appl Microbiol; 57 (3):145-151. 97. Lastella GC Testa G, Cornacchia M, Notornicola F,Voltasio and Sharma VK (2002) Anaerobic digestion of semi-solid organic waste: Biogas production and its purification. Energy Conversion and Management 43: 63-75. 98. Lê Trần Bình, Phan Văn Chi, Nông Văn Hải, Trương Nam Hải, Lê Quang Huấn (2003) Áp dụng các kỹ thuật phân tử trong nghiên cứu tài nguyên sinh vật Việt Nam. NXB Khoa học và Kỹ thuật, Hà Nội. 99. Lee KH and Kim BW (1998) Enhanced microbial removal of H2S using Chlorobium in an optical-fiber bioreactor. Biotechnol Lett 20: 525-529. 100. Lencina AM, Ding Z, Schurig-Briccio LA, Robert B (2012) Gennis Characterization of the Type III sulfide: quinone oxidoreductase from Caldivirga maquilingensis and its membrane binding. Biochim Biophys Acta. Mar 2013; 1827(3): 266-275. 101. Lucking D, Pike L, and Sojka G 1976 "Glycerol utilization by a mutant of Rhodopseudomonas capsulata" J. Bacteriol 125: 750-752. 102. Madigan MT (1988) "Microbiology, physiology and ecology of phototrophic bacteria", pp 59-111, In: Zehnder A.J.B (ed.), Biology of anaerobic microorganism, John Willey and Sons, Inc. New York. 130 103. Madigan MT (2001) The family Heliobacteriaceae. In: Dworkin M (ed) The Prokaryotes: an Evolving Electronic Resource for the Microbiological Community, 3rd edn. Springer, New York (release 3.5. 13 March 2001) 104. Madigan MT (2003) Anoxygenic phototrophic bacteria from extreme environments. Photosynth Res 76: 157-171. 105. Madigan MT, Martinko JM and Parker J (2000) Brock Biology of Microorganisms. 9thedn, Prentice-Hall Inc. 106. Madukasi EI, Chunhua; H, Zhang*G (2011) Isolation and application of a wild strain photosynthetic bacterium to environmental waste management. J.Environ. Sci. Tech, 8 (3): 513-522. 107. Madukasi EI; Dai XI, Chunhua H, Zhou JJ (2010) Potentials of phototrophic bacteria in treating pharmaceutical wastewater. Int. J. Environ. Sci. Tech, 7 (1): 165-174. 108. Maka A and Cork DJ (1990a) Introduction to the sulfur microorganisms and their applications in the environment and industry. Dev Ind Microbiol, 31: 99-102. 109. Maka A and Cork DJ (1990b) Quantum efficiency requirements for an anaerobic photobioreactor. J Ind Microbiol 5: 337-354. 110. Merrick MJ, and Edwards RA (1995) Nitrogen control in bacteria. Microbiological reviews, 59(4): 604-622. 111. Meyer TE, Bartsch RG (1976) Flavins and Flavoproteins, Singer, T.P. (Eds.) Elsevier, Amsterdam: 312-317. 112. Meyer TE, Bartsch RG, and Cusanovich MA (1991) Adduct formation between sulfite and the flavin of phototrophic bacterial flavocytochromes c. Kinetics of sequential bleach, recolor, and rebleach of flavin as a function of pH. Biochemistry, 30: 8840-8845. 113. Michael TM and Deborah OJ (2008) An overview of purple bacteria: Systematics, Physiology, and habitats in Hunter CN, Daldal F, Thurnauer MC, Beatty JT. (Eds.). Advances in Photosynthesis and Respiration. Vol 28:1-15. 131 114. Mukkata K, Kantachote D, Wittayaweerasak B, Techkarnjanaruk S, Boonapatcharoen N (2015) Diversity of purple nonsulfur bacteria in shrimp ponds with varying mercury levels. Saudi Journal of Biological Sciences. 115. Nguyễn Khắc Hải (2006). Ônhiễm môi trường công nghiệp và sức khỏe cộng đồng. Tạp chí bảo vệ môi trường tháng 09/2006. 116. Nguyễn Thành Đạt (2007) Cơ sở sinh học vi sinh vật, tập 2. Nhà xuất bản đại học Sư Phạm. 117. Nguyễn Thị Kim Ngân (1993) "Bài giảng Lý sinh" NXB Khoa học và Kỹ thuật: 116 trang. 118. Nguyễn Văn Hảo, Cao Thành Trung, Nguyễn Viết Dũng, Lê Hồng Phước (2014) Ứng dụng sinh học phân tử trong chẩn đoán bệnh tôm, cá nuôi tại Nam Bộ. Hội thảo toàn quốc về Nghiên cứu và Ứng dụng khoa học công nghệ trong nuôi trồng thủy sản. Vũng Tàu 12/2004. Nhà xuất bản nông nghiệp:729 - 748. 119. Okubo Y, Futamata H, Hiraishi A (2006) Characteriazation of phototrophic purple nonsulfur bacteria forming colored microbial mats in a swine wastewater ditch. Appl. Environ Microbiol, 72: 6225 - 6233. 120. Overmann J (2000) The family Chlorobiaceae. In: Dworkin M (ed) The Prokaryotes: an Evolving Electronic Resource for the Microbiological Community, 3rd edn. Springer, New York. ny.com/link/service/books/10125 (release 3.1. January 20, 2000). 121. Overmann J (2001) Green sulfur bacteria. In: Garrity GM (ed) Bergey’s Manual of Systematic Bacteriology, Springer, New York: 601-623. 122. Overmann J and Garcia-Pichel F (2000) The phototrophic way of life. In: Dworkin M (ed) The Prokaryotes: an Evolving Electronic Resource for the Microbiological Community, 3rd edn. Springer, New York. ny.com/ link/service/books/10125 (release 3.2. 25 July 2000) 123. Overmann J, and Schubert K (2002) Phototrophic consortia: Model systems for symbiotic interrelations between prokaryotes. Arch Microbiol 177: 201-208 132 124. Overmann J, Beatty JT, and Hall KJ (1994) Photosynthetic activity and population dynamics of Amoebobacter purpureus in a meromictic saline lake. FEMS Microbiol Ecol 15: 309-320 125. Overmann J, Beatty JT, and Hall KJ (1996) Purple sulfur bacteria control the growth of aerobic heterotrophic bacterioplankton in a meromictic salt lake. Appl Environ Microbiol 62: 3251-3258 126. Overmann J, Hall KJ, Northcote TG, and Beatty JT (1999) Grazing of the copepod Diaptomus connexus on purple sulphur bacteria in a meromictic salt lake. Environ Microbiol 1: 213-221. 127. Payne J, and Morris JG (1969) Acetate utilization by Rhodopseudomonas sphaeroides" FEBS. Lett. 4: 52-54. 128. Pfennig N (1974) Rhodopseudomonas globiformis, sp. n., a new species of the Rhodospirillaceae. Arch Microbiol 100: 197-206. 129. Pfennig N (1975) The phototrophic bacteria and their role in the sulfur cycle. Plant Soil 43: 1-16 130. Pfennig N (1978a) General physiology and ecology of photosynthetic bacteria. In: Clayton RK and Sistrom WR, (eds) The Photosynthetic Bacteria. Plenum Press, New York: 3-18 131. Pfennig N (1978b) Rhodocyclus purpureus gen. nov. and sp. nov., a ring- shape, vitamin B12-requiring member of the family Rhodospirillaceae. Int J Syst Bacteriol 28: 283-288. 132. Pfennig N and Trueper HG (1994) Anoxygenic Phototrophic Bacteria. In: Bergey’s manual of Determinative bacteriology, Holt JG, Koieg NR, sneath PHA, Staley JT, Williams ST (Eds), 9th Ed, The William & Wilkins Co, Baltimore. 133. Pfennig N and Trüper HG (1992) The family Chromatiaceae. In: Balows A, Trüper HG, Dworkin M, Harder W and Schleifer KH (eds) The Prokaryotes. Springer, New York, Vol III: 3200-3221 134. Pfennig N, and Truper HG (1994) Characterization and identification of the Anoxygenic Phototrophic Bacteria. In: The Prokaryote: a hanbook of on habitats, isolation and identification of bacteria. Springer-Verlag, Berlin: 299-311. 133 135. Pfennig N, Trueper HG (1992) Characterization and identification of the Anoxygenic Phototrophic Bacteria. In: The Prokaryote: a handbook of on habitats, isolation and identification of bacteria. Springer- Verlag, Berlin: 299-311. 136. Panwichian S, Kantachote D, Wittayaweerasak B, Mallavarapu M (2010) Isolation of purple nonsulfur bacteria for the removal of heavy metals and sodium from contaminated shrimp ponds. Electron. J. Biotechnol., 13 (4) 137. Quayle JR, and Keech DB (1959) Carboxydismutase activity in formate and oxalate-grown Pseudomonas oxalaticus (strain OX). Biochim. Biophys. Acta. 31:587-588 138. Quayle JR, and Pfennig N (1975) Utilization of methanol by Rhodospirillaceae, Arch. Microbiol. 102: 193-198. 139. Reinartz M, Tschaepe J, Brueser T, Trueper HG, Dahl C (1998) Sulfide oxidation in the phototrophic sulfur bacterium Chromatium vinosum. Arch Microbiol, 170: 59-68. 140. Roth SH (1993) Hydrogen sulfide. In Handbook of Hazardous Materials. New York, NY: Academic Press. 141. Saier JMH, Feucht BU, Roseman S (1971) Phosphoenolpyruvate -dependent fructose phosphorylation in photosynthetic bacteria, J. Biol. Chem. 246: 7819-7821. 142. Sambrook J, Russell DW (2001) Molecular Cloning. A laboratory manual, 3 st ed. Cold spring Harbor Laboratory, Cold spring Harbor, New York. 143. Sasaki K, Nopararnaraporn N, Nagai S (1991) Using of photosynthetic bacteria for the production of SCP and chemicals from agroindustrial waste, In: Bioconversion of waste materials to industrial products. Eds. Martin A.M. Elsevier science publishers, UK. Pp: 223-262. 144. Sasaki K, Takana T, Nishizawa Y, and Hayashi M (1990) identification of a herbicide 5 - aminolevulinic acid by Rhodobacter sphaeroides using of the effluent of swine waste from an anaerobic digestor. Appl. Microbiol. Biotechnol. 32:737 - 731. 134 145. Sasikala C, Ramana CV (1995) Biotechnological potential of photosynthetic bacteria I: Production of single cell protein, vitamins, ubiquinone, hormones, and enzymes and use in waste treatment. Adv. Appl. Microbiol. 41: 173-225. 146. Sasikala C, Ramana CV (1995b) Biotechnological potentials of photosynthetic bacteria II: Biopolyesters Biopesticide, Biofuel, and Biofertilizer, Advances in Applied Microbiology 41: 227-277. 147. Schon G, Voelskow H (1976) Pyruvate fermentation in Rhodospirillum rubrum after transfer from aerobic to anaerobic conditons in the dark, Arch. Microbiol. 107: 82-92. 148. Schütz M, Shahak Y, Padan E, Hauska GJ (1997) The Sulfide-Quinone- Reductase from Rhodobacter capsulatus: Purification, Sequencing and Expression. Biol Chem, 272: 9890-9894. 149. Schütz M, Klughammer C, Griesbeck C, Quentmeier A, Friedrich CG, and Hauska G (1998) Sulfide-quinone reductase (SQR) activity in membranes of the chemotrophic bacterium Paracoccus denitrificans Arch Microbiol, 170: 353-360. 150. Schütz M, Maldener I, Griesbeck C, Hauska GJ (1999) Sulfide-Chinon Reductase from Rhodobacter capsulatus - Requirement for Growth, Periplasmic Localization and Extension of Gene Sequence Analysis, Bacteriol, 181: 6516-6523. 151. Shahak Y, Arieli B, Padan E, Hauska G (1992) Sulfide quinone reductase (SQR) activity in Chlorobium. FEBS Lett, 299: 127- 130. 152. Shahak Y, Hauska G, Herrmann I, Arieli B, Taglicht D, Padan E (1992) Sulfide-quinone reductase (SQR) drives anoxygenic photosynthesis in prokaryotes. Research in Photosynthesis, Murata, N. (Eds.) Kluwer Academic Publishers, Netherlands: 483-486. 153. Shahak Y, Schutz M, Bronstein M, Griesbeck C, Hauska G, and Padan E (1997) Sulfide-dependent anoxygenic photosynthesis in prokaryotes: sulfide-quinone reductase (SQR), the initial step. In G. A. Peschek, W. Loffelhardt, and G. Schmetterer (ed.), Proceedings of the 9th International Symposium on Phototrophic Procaryotes (Vienna 1997). Plenum Press, New York, N.Y: 217-228. 135 154. Shahak Y, Schütz M, Bronstein M, Griesbeck C, Hauska G, and Padan E (1999) Sulfide-dependent anoxygenic photosynthesis in prokaryotes- sulfide- quinone reductase (SQR), the initial step. In G. A. Peschek, W. L. Loffelhardt, and G. Schmetterer (ed.), The phototrophic prokaryotes. Kluwer Academic/Plenum, New York, NY: 217-228 155. Shibata H and Kobayashi S (2001) Sulfide oxidation in gram- negative bacteria by expression of the sufide quinone reductase gene of Rhodobacter capsulatus and by electron transport to ubiquinone, Can. J. Microbiol. /Rev. can.microbiol 47(9): 855-860. 156. Shibata H, Takahashi M, Yamaguchi I, Kobayashi S (1999) Sulfide oxidation by gene expressions of sulfide-quinone oxidoreductase and ubiquinone-8 biosynthase in Escherichia coli. J Biosci Bioeng, 88: 244-249. 157. Stal LJ (1995) Physiological ecology of cyanobacteria in micro- bial mats and other com.munltiNew Phytol, 131: 1-32. 158. Steudel R,Gobel T, Holdt G (1990) Search for polythionates in culteres of Chromatium vinosum after sulfide incubation, Arch. Microbiol 153, 432 - 437. 159. Strümpfer J, Hsin J, Şener M, Chandler D and Schulten K (2011) The light- harvesting apparatus in purple photosynthetic bacteria, introduction to a quantum biological device, World Scientific. Molecular Machines, page 19. 160. Syed MA and Henshaw PF (2003) Effect of tube size on performance of a fixed-film tubular bioreactor for conversion of hydrogen sulfide to elemental sulfur. Water Res 37: 1932-1938. 161. Syed MA and Henshaw PF (2005) Light emitting diodes and an infrared bulb as light sources of a fixed-film tubular photobioreactor for conversion of hydrogen sulfide to elemental sulfur. J Chem Technol Biotechnol 80: 119-123. 162. Tabita FR (1995) "The biochemistry and metabolic regulation of metabolism and CO2 fixation in purple bacteria’’. In Anoxygenic phototrophic bacteria. Robert E. Blankenship (ed). Kluwer academic Publishers: 885-914. 136 163. Theissen U, Hoffmeister M, Grieshaber M, Martin W (2003) Single eubacterial origin of eukaryotic sulfide: quinone oxidoreductase,a mitochondrial enzyme conserved from the early evolution of eukaryotes during anoxic and sulfidic times. Mol BiolEvol 20: 1564-1574. 164. Tichi MA, and Tabita FR (2001) Intererative control of Rhodobacter capsulatus redox - balancing systems during phototrophic metabolism. J. Bacteriol. 183(21):6344 - 6354. 165. Trần Văn Nhị (2005) "Ánh sáng và cơ thể sống’’ Nhà xuất bản Đại học Quốc gia Hà Nội. 166. Trần Văn Nhị, Đỗ Thị Tố Uyên (1999) Nghiên cứu vi khuẩn quang hợp để sử dụng trong xử lý nước thải giàu hữu cơ II. Báo cáo Hội nghị Công nghệ sinh học toàn quốc 12/1999: 292 - 300. 167. Trüper HG (1984) Phototrophic bacteria and their sulfur metabolism. Stud Inorganic Chem 5: 367-382. 168. Trüper HG and Pfennig N (1992) The family Chlorobiaceae. In: Balows A, Trüper HG, Dworkin M, Harder W and Schleifer K-H (eds) The Prokaryotes. Springer, New York.,Vol III: 3583-3592 169. Van Driessche G, Koh M, Chen ZW, Mathews FS, Meyer TE, Bartsch RG, Cusanovich MA, Van Beeumen JJ (1996) Covalent structure of the flavoprotein subunit of the flavocytochrome c: sulfide dehydrogenase from the purple phototrophic bacterium Chromatium vinosum. Protein Science, 5: 1753-1764. 170. Van Niel CB (1944) "The culture, general physiology, morphology and classification of the non-sulfur purple and brown bacteria", Bacteriol. Rev. 8: 1-118. 171. Visscher PT, Nijburg JW, van Germerden H (1990) Polysulfide utilization by Thiocapsa roseopersicina. Arch. Microbiol 19: 199 - 202. 172. Visscher PT, Taylor BP (1993) Organic thiols as organolithotrophic substrate for growth of phototrophic bacteria, Appl. Environ. Microbiol 59: 93 -96. 173. Visser JM, De Jong GAH, Robertson LA, Kuenen JG (1997) A novel membrane-bound flavocytochrome c sulfide dehydrogenase from the colourless sulfur bacterium Thiobacillus sp. W5. Arch Microbiol, 167: 295-301. 137 174. Visser JM, Stefess GC, Robertson LA, Kuenen JG (1997) Thiobacillus sp. W5, the dominant autotroph oxidizing sulfide to sulfur in a reactor for aerobic treatment of sulfidic wastes. Antonie Van Leeuwenhoek, 72: 127-134. 175. Võ Thị Hạnh, Lê Thị Bích Phượng, Lê Tấn Hưng, Trương Thị Hồng Vân, Trần Thạch Phong (2004) Nghiên cứu sản xuất chế phẩm VEM dung trong nuôi trồng thủy sản. Hội thảo toàn quốc về nghiên cứu và ứng dụng khoa học công nghệ trong nuôi trồng thuỷ sản. Vũng Tàu 12/2004. NXB Nông nghiệp: 911-917. 176. Vũ Thị Minh Đức, Ninh Hoàng Oanh (2000) Một số đặc tính của vi khuẩn quang hợp tía không lưu huỳnh phân lập từ nước thải của vùng Hà Nội. báo cáo trong tuyển tập hội nghị sinh học quốc gia về Những vấn đề nghiên cứu cơ bản trong sinh học. NXB Đại học Quốc gia Hà Nội: 54 - 57. 177. Vũ Văn Vụ, Vũ Thanh Tâm, Hoàng Minh Tấn (2001) ‘’Sinh lý học thực vật’’ NXB Giáo dục: 252 trang. 178. Wani AH, Lau AK and Branion MR (1999) Biofiltration control of pulping odors - hydrogen sulphide: Performance, microkinetics and coexistence effects of organo-sulfur species. Journal of Chemical Technology and Biotechnology 74: 9-16. 179. Weaver PF, Wall DJ, Gest H (1975) Characterization of Rhodopseudomonas capsulata, Arch. Microbiol. 105: 207-216. 180. Willison JC (1988) Pyruvate and acetate metabolism in the photosynthetic bacterium Rhodobacter capsulatus", J. Gen. Microbiol. 134: 2429-2439. 181. Wraight CA (1982) Current researchs on photosynthesis, In Godvindjee (ed), Photosynthesis, vol.I, Academic Press. New York, London. 182. Zhu H, Ueda S, Asada Y, Miyaka J (2002) Hydrogen production as a novel process of wastewater treatment studies on Tofu wastewater with entrapped R. sphearoides and mutangenesis. Int.J. hydrogen Energ, 27: 1349 - 1357. PHỤ LỤC Phụ lục 1 Trình tự gen sqr chủng QN52 ID QN52 PRELIMINARY; DNA; 1296 BP. SQ SEQUENCE 1296 BP; 204 A; 461 C; 420 G; 211 T; CAATGGCGCA TGTCGTCGTT CTCGGGGCCG GTCTGGGCGG CTCGATCATG GCCTACGAGT TGCAGCAGCA ACTCCGCAGC GAGGACCGGA TCACCGTCGT GACCCGCGAT CCCACCTATC ACTTCGTGCC CTCCAACCCG TGGGTGGCGG TGGGTTGGCG GACGCGCAGC CATATCAGCG CCGATCTGGC ACCCACGATG CAGCGGCTCG GGATCGCCTT TCGGACGGTG CCCGCCACGC GCCTCGTGCC GGCCGAGAAC CGGGTGGAGC TCGCCGACGG CAGCGCGCTC GATTACGATT ACCTCGTGGT GGCGACCGGT CCCGAGCTTG CCTTCGACGA GATCGAGGGC TTCGGCCCCG AGGGCCACAC CCAGTCCATC TGCCATATCG ACCATGCCGA GGCCGCCCAC GCGGCCTTCG AGCGGTTCTG CGAGACCCCG GGCCCCATCG TGGTGGGGGC CGCGCAGGGC GCGAGCTGCT TCGGCCCGGC CTACGAATTC GCCTTCATCC TCGATGCGGC CCTGCGTCGG CGCAAGATCC GCGACCGGGT GCCCATGACC TTCGTCACCT CCGAACCCTA TATCGGCCAT CTCGGCCTCG ACGGAGTGGG CGACACCAAG GGGCTGCTCG AATCCGCGCT GCGCAGCCGC CATATCAAAT GGATCACCCC GGCCCGGATC TCGCGGGTCG AGGCGGGGAT GATGCATGTC GAGGAAGTGG CCGAGGGCGG CGCCACGAAG CCCCATGCCC TGCCCTTCGG CTATGCGATG ATGCTGCCCG CCTTCCGGGG GGTGAAGGCC GTCTCGGGCA TCGAGGGGCT CTCGAACCCG CGCGGCTTCA CCCTCGTCGA TCCTCATCAG CGCAACCCCG CCTTCCCGAA CATCTTCGCC GTGGGCGTCT GCGTGGCGAT CCCGCCGATG GGGGCCACGC CGGTGCCGGT GGGCGTGCCC AAGACCGGCT TCATGATCGA ATCGATGGTC ACCGCCACGG CGCACAACAT CGGCGCGCTG GTCCGCGGCA AGGAGCCCGA CGAGGTCGCC ACCTGGAACG CGGTCTGTCT CGCCGATTTC GGCGACCGCG GCATCGCCTT CATCGCCCAG CCGCAGATCC CGCCGCGCAA CGTGAACTGG TCGGCCGAGG GCCGCTGGGT CCATTTCGCC AAGATCGCCT TCGAGAAATA CTTCCTGCGC AAGGTGAAGC TCGGCACCGC CGAGCCGCTT TACGAATGGG CGGCGATGAA GATGCTCGGC ATCGACAAGC TCAAGGCCGC GCGCAAGGGA TGACCCCTTG CCAATC Phụ lục 2 Trình tự gen sqr chủng QN71 ID QN71 PRELIMINARY; DNA; 1296 BP. SQ SEQUENCE 1296 BP; 210 A; 453 C; 417 G; 216 T; CAATGGCGCA TGTCGTCGTT CTCGGGGCCG GTCTGGGCGG CTCGATCATG GCCTACGAGT TGCAGCAGCA ACTCCGCAGC GAAGACCGGA TCACTGTCGT GACCCGCGAT CCCACCTATC ATTTCGTGCC CTCCAACCCG TGGGTGGCGG TGGGCTGGCG GACGCGCAGC CATATCAGCG CCGATCTGGC GCCGACGATG CAGCGGCTCG GGTTCGCCTT TCGGACGGTG CCCGCCACGC GCCTCGTGCT GGCCGAGAAC CGGGTGGAGC TCGCCGACGG CACTGCGCTC GATTACGATT ACCTCGTGGT GGCGACCGGC CCCGAGCTTG CCTTCGACGA GATCGAGGGC TTCGGACCCG AGGGCCACAC CCAGTCCATC TGCCACGTCG ACCATGCCGA GGCCGCCCAC GCGGCCTTCG AGCGGTTCTG CGAAAACCCC GGCCCCATCG TGGTGGGGGC GGCGCAGGGC GCGAGCTGCT TCGGGCCCGC CTACGAATTC GCCTTCATCC TCGATGCAGC CCTGCGCCGA CGCAGGATCC GCGACCGGGT GCCCATGACC TTCGTCACCT CCGAACCCTA TATCGGCCAT CTCGGCCTCG ACGGGGTGGA CGACACGAAG GGGCTGCTCG AATCCGCGCT GCGCAGCCGC CATATCAAAT GGATCACCTC GGCCCGGATC TCGCGGGTCG AGGCGGGGAT GATGCATGTC GAAGAAGTGT CCGAGGGCGG CGCCACGAAG CCCCATGCCC TGCCCTTCGG CTATGCGATG ATGCTGCCTG CCTTCCGGGG GGTGAAGGCT GTCTCGGGCA TCGAGGGGCT CTCGAACCCG CGCGGCTTCA CCCTCGTCGA TCCTCACCAG CGCAACCCCA CCTTCCCCAA CATCTTCGCG GTGGGCGTCT GCGTGGCAAT CCCGCCGATG GGGGTCACGC CGGTGCCGGT GGGCGTGCCC AAGACCGGCT TCATGATCGA ATCGATGGTC ACCGCCACGG CGCACAACAT CGGCGCGCTG GTCCGCGGCA AGGAACCCGA CGAGGTCGCC ACCTGGAACG CGGTCTGCCT CGCCGATTTC GGCGACCGCG GCATCGCCTT CATCGCCCAG CCGCAGATCC CGCCGCGCGA CGTGAACTGG TCGGCCGAGG GTCGCTGGGT GCATTTCGCC AAGATCGCCT TCGAGAAATA CTTCCTGCGC AAGGTGAAGC TCGGCACGGC CGAGCCGCTT TACGAATGGG CGGCAATGAA GATGCTCGGG ATCGACAAGC TCAAGGCCGC CCGCAAGGGA TGACCCCTTG CCAATC Phụ lục 3 Trình tự gen sqr chủng TH21 ID TH21 PRELIMINARY; DNA; 1299 BP. SQ SEQUENCE 1299 BP; 210 A; 454 C; 420 G; 215 T; CAATGGCGCA TGTCGTCGTT CTCGGGGCCG GTCTGGGCGG CTCGATCATG GCCTACGAGT TGCAGCAGCA ACTCCGCAGC GAAGACCGGA TCACTGTCGT GACCCGCGAT CCCACCTATC ATTTCGTGCC CTCCAACCCG TGGGTGGCGG TGGGCTGGCG GACGCGCAGC CATATCAGCG CCGATCTGGC GCCGACGATG CAGCGGCTCG GGTTCGCCTT TCGGACGGTG CCCGCCACGC GCCTCGTGCT GGCCGAGAAC CGGGTGGAGC TCGCCGACGG CACTGCGCTC GATTACGATT ACCTCGTGGT GGCGACCGGC CCCGAGCTTG CCTTCGACGA GATCGAGGGC TTCGGACCCG AGGGCCACAC CCAGTCCATC TGCCACGTCG ACCATGCCGA GGCCGCCCAC GCGGCCTTCG AGCGGTTCTG CGAAAACCCC GGCCCCATCG TGGTGGGGGC GGCGCAGGGC GCGAGCTGCT TCGGGCCCGC CTACGAATTC GCCTTCATCC TCGATGCAGC CCTGCGCCGA CGCAGGATCC GCGACCGGGT GCCCATGACC TTCGTCACCT CCGAACCCTA TATCGGCCAT CTCGGCCTCG ACGGGGTGGA CGACACGAAG GGGCTGCTCG AATCCGCGCT GCGCAGCCGC CATATCAAAT GGATCACCTC GGCCCGGATC TCGCGGGTCG AGGCGGGGAT GATGCATGTC GAAGAAGTGT CCGAGGGCGG CGCCACGAAG CCCCATGCCC TGCCCTTCGG CTATGCGATG ATGCTGCCTG CCTTCCGGGG GGGTGAAGGG CTGTCTCGGG CATCGAGGGG CTCTCGGACC CGCGCGGCTT CACCCTCGTC GATCCTCACC AGCGCAACCC CACCTTCCCC AACATCTTCG CCGGTGGGCG TCTGCGTGGC AATCCCGCCG ATGGGGGTCA CGCCGGTGCC GGTGGGCGTG CCCAAGACCG GCTTCATGAT CGAATCGATG GTCACCGCCA CGGCGCACAA CATCGGCGCG CTGGTCCGCG GCAAGGAACC CGACGAGGTC GCCACCTGGA AAGCGGTCTG CCTCGCCGAT TTCGGCGACC GCGGCATCGC CTTCATCGCC CAGCCGCAGA TCCCGCCGCG CAACGTGAAC TGGTCGGCCG AGGGCCGCTG GGTGCATTTC GCCAAGATCG CCTTCGAGAA ATACTTCCTG CGCAAGGTGA AGCTCGGCAC GGCCGAGCCG CTTTACGAAT GGGCGGCGAT GAAGATGCTC GGGATCGACA AGCTCAAGGC CGCCCGCAAG GGATGACCCC TTGCCAATC Phụ lục 4 Dịch mã gen sqr chủng QN52 5 10 15 20 25 30 | | | | | | 1 M A H V V V L G A G L G G S I M A Y E L Q Q Q L R S E D R I 31 T V V T R D P T Y H F V P S N P W V A V G W R T R S H I S A 61 D L A P T M Q R L G I A F R T V P A T R L V P A E N R V E L 91 A D G S A L D Y D Y L V V A T G P E L A F D E I E G F G P E 121 G H T Q S I C H I D H A E A A H A A F E R F C E T P G P I V 151 V G A A Q G A S C F G P A Y E F A F I L D A A L R R R K I R 181 D R V P M T F V T S E P Y I G H L G L D G V G D T K G L L E 211 S A L R S R H I K W I T P A R I S R V E A G M M H V E E V A 241 E G G A T K P H A L P F G Y A M M L P A F R G V K A V S G I 271 E G L S N P R G F T L V D P H Q R N P A F P N I F A V G V C 301 V A I P P M G A T P V P V G V P K T G F M I E S M V T A T A 331 H N I G A L V R G K E P D E V A T W N A V C L A D F G D R G 361 I A F I A Q P Q I P P R N V N W S A E G R W V H F A K I A F 391 E K Y F L R K V K L G T A E P L Y E W A A M K M L G I D K L 421 K A A R K G Amino acid composition. 54 A 5 C 14 H 13 M 22 T 28 R 9 Q 24 I 21 F 7 W 9 N 26 E 29 L 31 P 9 Y 17 D 40 G 15 K 16 S 37 V Number of residues: 426 Molecular weight (MW): 46225 ; Checking number (CN): 901656 This sequence is a translation of sequence QN52. From base 3 to base 1280. Phụ lục 5 Dịch mã gen sqr chủng QN71 5 10 15 20 25 30 | | | | | | 1 M A H V V V L G A G L G G S I M A Y E L Q Q Q L R S E D R I 31 T V V T R D P T Y H F V P S N P W V A V G W R T R S H I S A 61 D L A P T M Q R L G F A F R T V P A T R L V L A E N R V E L 91 A D G T A L D Y D Y L V V A T G P E L A F D E I E G F G P E 121 G H T Q S I C H V D H A E A A H A A F E R F C E N P G P I V 151 V G A A Q G A S C F G P A Y E F A F I L D A A L R R R R I R 181 D R V P M T F V T S E P Y I G H L G L D G V D D T K G L L E 211 S A L R S R H I K W I T S A R I S R V E A G M M H V E E V S 241 E G G A T K P H A L P F G Y A M M L P A F R G V K A V S G I 271 E G L S N P R G F T L V D P H Q R N P T F P N I F A V G V C 301 V A I P P M G V T P V P V G V P K T G F M I E S M V T A T A 331 H N I G A L V R G K E P D E V A T W N A V C L A D F G D R G 361 I A F I A Q P Q I P P R D V N W S A E G R W V H F A K I A F 391 E K Y F L R K V K L G T A E P L Y E W A A M K M L G I D K L 421 K A A R K G Amino acid composition. 51 A 5 C 14 H 13 M 23 T 29 R 9 Q 22 I 22 F 7 W 9 N 26 E 30 L 29 P 9 Y 19 D 39 G 14 K 17 S 39 V Number of residues: 426 Molecular weight (MW): 46439 ; Checking number (CN): 913058 This sequence is a translation of sequence QN71. From base 3 to base 1280. Phụ lục 6 Dịch mã gen sqr chủng TH21 5 10 15 20 25 30 | | | | | | 1 M A H V V V L G A G L G G S I M A Y E L Q Q Q L R S E D R I 31 T V V T R D P T Y H F V P S N P W V A V G W R T R S H I S A 61 D L A P T M Q R L G F A F R T V P A T R L V L A E N R V E L 91 A D G T A L D Y D Y L V V A T G P E L A F D E I E G F G P E 121 G H T Q S I C H V D H A E A A H A A F E R F C E N P G P I V 151 V G A A Q G A S C F G P A Y E F A F I L D A A L R R R R I R 181 D R V P M T F V T S E P Y I G H L G L D G V D D T K G L L E 211 S A L R S R H I K W I T S A R I S R V E A G M M H V E E V S 241 E G G A T K P H A L P F G Y A M M L P A F R G G E G L S R A 271 S R G S R T R A A S P S S I L T S A T P P S P T S S P V G V 301 C V A I P P M G V T P V P V G V P K T G F M I E S M V T A T 331 A H N I G A L V R G K E P D E V A T W K A V C L A D F G D R 361 G I A F I A Q P Q I P P R N V N W S A E G R W V H F A K I A 391 F E K Y F L R K V K L G T A E P L Y E W A A M K M L G I D K 421 L K A A R K G Amino acid composition. 53 A 5 C 13 H 13 M 25 T 31 R 8 Q 21 I 19 F 7 W 6 N 26 E 30 L 30 P 9 Y 17 D 39 G 14 K 25 S 36 V Number of residues: 427 Molecular weight (MW): 46200 ; Checking number (CN): 927281 This sequence is a translation of sequence TH21. From base 3 to base 1283. Phụ lục 7 So sánh trình tự protein SQR ở hai chủng QN52và TH21 * ALIGNMENT OF TWO PROTEIN SEQUENCES. * The two sequences to be aligned are: QN52_PROT. Total number of residues: 426. TH21_PROT. Total number of residues: 427. Comparison matrix : Structure-genetic matrix. Open gap cost : 7 Unit gap cost : 1 The character to show that two aligned residues are identical is '|' QN52_PROT - MAHVVVLGAGLGGSIMAYELQQQLRSEDRITVVTRDPTYHFVPSNPWVAV -50 |||||||||||||||||||||||||||||||||||||||||||||||||| TH21_PROT - MAHVVVLGAGLGGSIMAYELQQQLRSEDRITVVTRDPTYHFVPSNPWVAV -50 QN52_PROT - GWRTRSHISADLAPTMQRLGIAFRTVPATRLVPAENRVELADGSALDYDY -100 |||||||||||||||||||| ||||||||||| |||||||||| |||||| TH21_PROT - GWRTRSHISADLAPTMQRLGFAFRTVPATRLVLAENRVELADGTALDYDY -100 QN52_PROT - LVVATGPELAFDEIEGFGPEGHTQSICHIDHAEAAHAAFERFCETPGPIV -150 |||||||||||||||||||||||||||| ||||||||||||||| ||||| TH21_PROT - LVVATGPELAFDEIEGFGPEGHTQSICHVDHAEAAHAAFERFCENPGPIV -150 QN52_PROT - VGAAQGASCFGPAYEFAFILDAALRRRKIRDRVPMTFVTSEPYIGHLGLD -200 ||||||||||||||||||||||||||| |||||||||||||||||||||| TH21_PROT - VGAAQGASCFGPAYEFAFILDAALRRRRIRDRVPMTFVTSEPYIGHLGLD -200 QN52_PROT - GVGDTKGLLESALRSRHIKWITPARISRVEAGMMHVEEVAEGGATKPHAL -250 || ||||||||||||||||||| |||||||||||||||| |||||||||| TH21_PROT - GVDDTKGLLESALRSRHIKWITSARISRVEAGMMHVEEVSEGGATKPHAL -250 QN52_PROT - PFGYAMMLPAFRGVKAVSGIEGLSNPRGFTLVDPHQR------------- -287 ||||||||||||| | | TH21_PROT - PFGYAMMLPAFRGGEGLS------------------RASRGSRTRAASPS -282 QN52_PROT - ------NPAFPNIFAVGVCVAIPPMGATPVPVGVPKTGFMIESMVTATAH -331 | | ||||||||||| ||||||||||||||||||||||| TH21_PROT - SILTSATPPSPTSSPVGVCVAIPPMGVTPVPVGVPKTGFMIESMVTATAH -332 QN52_PROT - NIGALVRGKEPDEVATWNAVCLADFGDRGIAFIAQPQIPPRNVNWSAEGR -381 ||||||||||||||||| |||||||||||||||||||||||||||||||| TH21_PROT - NIGALVRGKEPDEVATWKAVCLADFGDRGIAFIAQPQIPPRNVNWSAEGR -382 QN52_PROT - WVHFAKIAFEKYFLRKVKLGTAEPLYEWAAMKMLGIDKLKAARKG -426 ||||||||||||||||||||||||||||||||||||||||||||| TH21_PROT - WVHFAKIAFEKYFLRKVKLGTAEPLYEWAAMKMLGIDKLKAARKG -427 Identity : 386 (90.61%) Number of gaps inserted in QN52_PROT: 1 Number of gaps inserted in TH21_PROT: 1 Phụ lục 8 Trình tự gen pufM chủng QN52 TGGACCTGTTCTACAACCCCTTCCACGGTCTCTCGATCGCCTTCCTCTACGGTTCGGCCCTGCTCTTCGCGAT GCACGGTGCGACCATCCTCGCGGTCTCCCGCTTCGGCGGCGAGCGCGAGCTGGAGCAGATCGCCGACCGCGGG ACGGCGGCGGAGCGGGCGGCCCTCTTCTGGCGCTGGACCATGGGA Description Max score Total score Quer y cover E value Ident Accession Rhodobacter sphaeroides ATCC 17025, complete genome 346 346 97% 8e-92 100% CP000661.1 Rhodobacter azotoformans pufL, pufM genes for photoreaction center L subunit, photoreaction center M subunit, partial cds 340 340 97% 4e-90 99% AB062783.1 Rhodobacter johrii partial pufM gene for photosynthetic reaction centre M subunit, type strain JA192T 331 331 98% 2e-87 98% HE966449.1 Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence 329 329 97% 8e-87 98% CP000143.2 Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence 329 329 97% 8e-87 98% CP000577.1 Rhodobacter sphaeroides photosynthetic gene cluster 329 329 97% 8e-87 98% AJ010302.1 R.sphaeroides reaction center protein m subunit gene and 5' flank 329 329 97% 8e-87 98% K00827.1 Rhodobacter megalophilus partial pufM gene for photosynthetic reaction centre M subunit, type strain JA194T 326 326 98% 1e-85 98% HE966451.1 R.sphaeroides Y pufM gene for polypeptide M of reaction centre 324 324 97% 4e-85 98% X63405.1 Rhodobacter sphaeroides strain 2.4.1 PufM (pufM) gene, partial cds 322 322 91% 1e-84 100% DQ017878.1 Phụ lục 9 Trình tự gen pufM chủng QN71 AGAGTGAGCTCGTCCCGGCACCTGTTCTACACCCCTTCCACGGTCTCTCGATCGCCTTCCTCTACGGGTCGGC CCTGCTCTTCGCGATGCACGGCGCGACCATCCTCGCGGTCTCCCGCTTCGGCGGCGAGCGCGAGCTGGAGCAG ATCGCCGACCGCGGGACGGCAGCGGAGCGGGCCGCCCTCTTCTGGCGCTGGACCATGGGA Description Max score Total score Query cover E value Ident Accession Rhodobacter johrii partial pufM gene for photosynthetic reaction centre M subunit, type strain JA192T 348 348 96% 3e-92 98% HE966449.1 Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence 346 346 96% 9e-92 98% CP000143.2 Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence 346 346 96% 9e-92 98% CP000577.1 Rhodobacter sphaeroides photosynthetic gene cluster 346 346 96% 9e-92 98% AJ010302.1 R.sphaeroides reaction center protein m subunit gene and 5' flank 346 346 96% 9e-92 98% K00827.1 Rhodobacter megalophilus partial pufM gene for photosynthetic reaction centre M subunit, type strain JA194T 342 342 96% 1e-90 98% HE966451.1 R.sphaeroides Y pufM gene for polypeptide M of reaction centre 340 340 96% 4e-90 98% X63405.1 Rhodobacter sphaeroides KD131 chromosome 1, complete sequence 335 335 96% 2e-88 97% CP001150.1 Rhodobacter sphaeroides photosynthetic gene cluster, partial sequence 335 335 96% 2e-88 97% AF195122.1 Rhodobacter sphaeroides ATCC 17025, complete genome 324 324 96% 4e-85 96% CP000661.1 Rhodobacter azotoformans pufL, pufM genes for photoreaction center L subunit, photoreaction center M subunit, partial cds 318 318 96% 2e-83 96% AB062783.1 Rhodobacter sphaeroides strain 2.4.1 PufM (pufM) gene, partial cds 300 300 89% 7e-78 96% DQ017878.1 Phụ lục 10 Trình tự gen pufM chủng TH21 GTTCATTTTCAACCGGGGTGAACCTGGCTCTACCGGCCCTTTCACGGATCTCTCGATCGCCTTCCTCTACCGT TCGGCCCTGCTCTTCGCGATGCACGGTGCGACCATCCTCGCGGTCTCCCGCTTCGGCGGCGAGCGCGAGCTGG AGCAGATCGCCGACCGCGGGACGGCGGCGGAGCGGGCGGCCCTCTTCTGGCGCTGGACCATGGGA Description Max score Total score Query cover E value Ident Accession Rhodobacter sphaeroides ATCC 17025, complete genome 307 307 90% 4e-80 96% CP000661.1 Rhodobacter azotoformans pufL, pufM genes for photoreaction center L subunit, photoreaction center M subunit, partial cds 302 302 90% 2e-78 95% AB062783.1 Rhodobacter johrii partial pufM gene for photosynthetic reaction centre M subunit, type strain JA192T 291 291 90% 4e-75 94% HE966449.1 Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence 289 289 90% 2e-74 94% CP000143.2 Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence 289 289 90% 2e-74 94% CP000577.1 Rhodobacter sphaeroides photosynthetic gene cluster 289 289 90% 2e-74 94% AJ010302.1 R.sphaeroides reaction center protein m subunit gene and 5' flank 289 289 90% 2e-74 94% K00827.1 Rhodobacter megalophilus partial pufM gene for photosynthetic reaction centre M subunit, type strain JA194T 285 285 90% 2e-73 94% HE966451.1 Rhodobacter sphaeroides KD131 chromosome 1, complete sequence 283 283 90% 7e-73 94% CP001150.1 Rhodobacter sphaeroides strain 2.4.1 PufM (pufM) gene, partial cds 283 283 84% 7e-73 96% DQ017878. 1 R.sphaeroides Y pufM gene for polypeptide M of reaction centre 283 283 90% 7e-73 94% X63405.1 Rhodobacter sphaeroides photosynthetic gene cluster, partial sequence Phụ lục 11 Phương pháp xác định hàm lượng sulfide bằng phương pháp so màu * Phạm vi áp dụng Có thể sử dụng phương pháp này để xác định sulfide hòa tan và sulfide tổng số trong nước ăn uống, nước mặt, nước biển, nước thải công nghiệp Phương pháp này thích hợp cho khoảng nồng độ ≤ 20 mgS/l. * Nguyên tắc của phương pháp Sulfide phản ứng với dimethyl-p-phenylenediamin (p-aminodimethylanilin) khi có mặt FeCl3 để tạo ra xanh methylen, một chất nhuộm được xác định tại bước sóng cực đại 625nm. * Hóa chất Dung dịch gốc amino-sulfuric acid: hòa tan 27g p-aminodimethylalanin trong máy trộn lạnh với 50 ml acid H2SO4 đậm đặc và 20ml nước cất trong bình định mức có thể tích 100 ml. Giữ mát và pha loãng đến vạch dấu, thuốc thử mới pha cần được giữ trong bình tối màu. - Dung dịch A (thuốc thử acid amino-sulfuric): Hòa tan 25 ml dung dịch gốc acid amino-sulfuric acid với 975ml dung dịch (1+1) H2SO4, dung dịch này được gọi là dung dịch A. Dung dịch này phải trong suốt và giữ trong bình tối màu. - Dung dịch B (dung dịch Fecl3): hòa tan 100g FeCl3.6H2O trong 40ml nước cất. - Dung dịch C: (dung dịch diamonium hydrogen phosphat): hòa tan 400g (NH4)2HPO4 trong 800 ml nước cất. * Xây dựng dãy nồng độ chuẩn Dung dịch chuẩn gốc: Hòa tan 0,375g Na2S.9H2O vào 10ml nước cất đã được sục khí N2 để hàm lượng khí oxy trong nước = 0 mg/l. Dung dịch này có nồng độ 5000 mgS2-/l và được gọi là dung dịch gốc. Dung dịch chuẩn gốc pha loãng: dung dịch chuẩn gốc pha loãng100 lần để sao cho dung dịch chuẩn gốc pha loãng đạt nồng độ 50 mgS2-/l. Xây dựng đường chuẩn: Tỷ lệ dung dịch chuẩn gốc pha loãng với nước cất (ml+ml) Hàm lượng sulfide trong dung dịch pha loãng (mgS2-/l) 0,075+7,425 0.5 0,15+7,35 1 0,30+7,20 2 0,45+7,05 3 0,60+6,90 4 0,75 +6,75 5 * Cách tiến hành Chuyển 7.5 ml mẫu có chứa sulfide vào ống nghiệm thủy tinh, sau đó thêm 0.5ml dung dịch A và 0.15ml dung dịch B rồi lắc đều ống chỉ 1 lần. Đợi sau 3÷5 phút bổ sung 0.8ml dung dịch C lắc đều và đợi tiếp 3÷5 phút và tiến hành đo màu trên máy quang phổ ở bước sóng 625nm. Mẫu đối chứng là nước cất và tiến hành tương tự đối với mẫu thí nghiệm. Mật độ hấp thụ của dung dịch mẫu được so sánh với dịch chứa sulfide chuẩn ở một số nồng độ đã làm ở đường chuẩn trên và căn cứ vào đó để xác định hàm lượng sulfide có trong mẫu. * Cách tính Hàm lượng sulfide có trong dịch nghiên cứu được tính theo công thức: OD mẫu (mgS2-/l) = OD chuẩn x nồng độ chuẩn(mg/l) x độ pha loãng mẫu . Phụ lục 12 Phân tích sulfide bằng phương pháp iodine * Phương pháp này áp dụng cho phân tích hàm lượng sulfide trong nước và trong bùn chứa nhiều hơn 0,5 mgS/l. * Phương pháp lấy mẫu: Thể tích mẫu lấy để xác định sulfide không nhỏ hơn 200ml. Mẫu nước và mẫu bùn lấy để xác định sulfide cần phải lấy riêng và nếu không phân tích ngay phải cố định sulfide bằng dung dịch chì axetat hoặc dung dịch cadmi axetat 10%. * Xác định sulfide dựa trên nguyên tắc xác định H2S và muối của nó tạo thành kết tủa CdS, PbS. Hòa tan kết tủa bằng dung dịch iot. Sau đó chuẩn độ lượng iot dư bằng thiosunfat. * Dụng cụ và thuốc thử: Bình nón, buret, pipet; Axitclohidric tinh khiết, dung dịch 1:1; Cadmi axetat dung dịch 10%; Natri thiosunfat, dung dịch 0,01N; Iot, dung dịch 0,01 N; Tinh bột, dung dịch 0,5 % * Cách tiến hành - Xác định sơ bộ Nếu phân tích ngay sau khi lấy mẫu, không cần cố định mẫu. Lấy 20 ml nước thử, axit hóa bằng axit clohidric, thêm một lượng nhỏ dung dịch iot, 0,01 N cho đến khi xuất hiện màu vàng chuẩn độ ngược lượng iot dư bằng dung dịch natri thiosunfat 0,01 N. - Xác định chính xác. Dựa trên kết quả phân tích sơ bộ, ta lấy một lượng nước có chứa từ 5 ÷ 20 mg sunfua. Thêm vào đấy một lượng đủ cadmi axetat. Để tĩnh cho tới khi kết tủa lắng xuống. Lọc kết tủa và rửa tủa cẩn thận bằng nước nóng. Kết tủa sau khi lọc rửa chuyển vào bình nón, dung tích 250 ml. Thêm vào đó 25 ÷ 50 ml dung dịch iot 0,01 N và axit hóa dung dịch đó bằng 5 ml axit clohidric. Chuẩn độ lượng iot dư bằng natri thiosunfat 0,01 N (ghi số ml) * Tính kết quả Hàm lượng H2S (x) tính bằng mg/l theo công thức: V 1000 . 17,0).ba( x − = Trong đó: a - lượng dung dịch iot 0,01 N, ml; b - Lượng dung dịch natri thiosunfat, ml; V - thể tích nước lấy để phân tích, ml; 0,17 - số mg H2S tương đương với 1 ml dung dịch iot 0,01 N. Phụ lục 13 Phương pháp xác định BOD3 Xác định nhu cầu sinh hóa oxy (được viết tắc là BOD) (TCVN 4566 – 88) theo phương pháp Winkler. * Phương pháp lấy mẫu Lấy mẫu theo TCVN 4556-88. Nước chưa phân tích ngay phải bảo quản ở điều kiện nhỏ hơn 4o C. Chai chứa mẫu để xác định nhu cầu sinh hóa oxy phải sấy để tiệt trùng ở 150o C * Phương pháp xác định Nguyên tắc nhu cầu sinh hóa oxy là lượng oxy cần thiết để vi sinh vật phân huỷ các chất hữu cơ trong một đơn vị thể tích nước nhất định (1000 ml) trong một đơn vị thời gian nhất định, trong điều kiện nhiệt độ là 20o C và không có ánh sáng. Để xác định lượng oxy đó cần phải cung cấp cho nước thải một lượng oxy thừa đủ cho quá trình phân huỷ các chất hữu cơ do các vi sinh vật (quá trình đó có thể là: 3; 5; 10; 15 ngày tùy theo yêu cầu nghiên cứu). Lượng oxy trong nước giảm đi so với ngày đầu cho biết số mg oxy mà các vi sinh vật đã tiêu thụ. Yếu tố cản trở: Kiềm hoặc axit ảnh hưởng đến kết quả xác định, do đó phải thực hiện trong môi trường trung tính. Có thể dùng axit sunfuric H2SO4 0,05M hay natri hidroxit NaOH 0,1 M để xác định điều chỉnh. Nước đục, có nhiều cặn phải để lắng rồi lấy phần nước trong để xác định. Nước chứa clo hoạt động cản trở phải loại trừ clo như sau: Trong 100 ml nước nghiên cứu cho vào 10 ml kali iodua KI 10%, 10 ml axit axetic 5%, nhỏ vài giọt hồ tinh bột nếu xuất hiện màu tím xanh, nhỏ natri thiosunfat Na2S2O3 0,0125 M cho tới khi mất màu. * Dụng cụ và thuốc thử Dụng cụ Chai Winkler có thể tích biết sẵn hay chai 250 ml nút mài, buret, pipet, bình nón, tủ điều nhiệt. Thuốc thử Dung dịch dinh dưỡng dùng để bão hoà oxy gồm: Kali dihidrophotphat KH2PO4 2,785 g; Dinatri hidrophotphat Na2HPO4.2H2O 8,493g; Magiê sunfat MgSO4.7H2O 4,5g; Canxi clorua khan CaCl2 khan 5,5 mg; Amoniclrua NH4Cl 0,4gc thể pha riêng từng thứ mỗi thứ đủ 1.000 ml. Khi dùng lấy mỗi thứ 1ml rồi pha chung vào 1000 ml hoặc pha tất cả các thứ trên vào trong một bình thêm nước cất đến đủ 1000 ml. Các thuốc thử khác theo TCVN 4564-88 về xác định oxy hoà tan. Nước cất được sục khí để có hàm lượng từ 8 – 10 mg oxy trong một lít dùng để pha với nước thải. Dùng dung dịch dinh dưỡng (phần thuốc thử) pha vào nước cất. Lấy 1 – 2 ml dung dịch dinh dưỡng pha trong 1000 ml nước cất, khuấy đều, đem định lượng, nếu lượng oxy trong nước có từ 8 – 10 mg trong một lít là được. * Cách tiến hành Định lượng oxy của nước dùng để pha loãng. Lấy nước đã bào hoà oxy và hai chai nút nhám 250 ml (dùng ống xi phông đưa nước vào đáy chai, không được để bọt khí). Chai thứ nhất đem định lượng oxy, kết quả định lượng chai thứ nhất tính ra mg/l sẽ là 0d1. Chai thứ hai giữ lại ở điều kiện nhiệt độ 20o C ÷ 1o C và tránh ánh sáng. Sau 3 ngày (5, 10, 15, ngày tuỳ yêu cầu nghiên cứu) đem định lượng oxy của chai thứ hai cho kết quả 0d3. Hiệu số giữa 0d1 và 0d3 cho biết lượng oxy tiêu thụ sau ba ngày của nước dùng để pha loãng. Lượng oxy này không vượt quá 0,5 mg/l. Định lượng oxy của nước thải đã pha loãng. Lấy nước thải đã được pha loãng bằng nước bão hoà oxy vào hai chai nút nhám dung tích 250ml. Chai thứ nhất định lượng ngay. Kết quả tính ra mgO2/l ghi là OD1. Chai thứ nhất để sau 3, 5, 10, 15, ngày (cùng điều kiện nhiệt độ và tránh ánh sáng), đem định lượng oxy. Kết quả tính ra mg O2/l ghi là OD3. Hiệu số giữa OD1 và OD3 cho biết lượng oxy đã tiêu thụ sau 3 ngày đối với nước thải pha loãng Tính kết quả lượng oxy tiêu thụ sau 3 ngày hay nhu cầu sinh hóa oxy tính ra mg/l sẽ là: BOD3 = [(OD1 – OD3) – (Od1 – Od3)] x độ pha loãng mẫu. Cũng tính như vậy với BOD5, BOD10, BOD15. Chú thích: Lượng oxy hoà tan còn lại ở ngày cuối cùng phải còn lại từ 1 – 2 mg/l. Phụ lục 14 Định lượng amoni trong nước ngọt theo phương pháp Nessler Hàm lượng amoni trong mẫu nghiên cứu được xác định thông qua phản ứng màu vàng với thuốc thử Nessler, có khả năng hấp thụ ánh sáng ở bước sóng 420 nm, cường độ màu tỷ lệ thuận với nồng độ NH4+ có trong dung dịch. Thuốc thử Nessler: Pha 10g KI trong 10ml nước cất, thêm từ từ dung dịch HgCl2 bão hòa đến khi xuất hiện tủa đỏ bền. Bổ sung 30 g KOH. Thêm 10ml dung dịch HgCl2 bão hòa, thêm nước cất đến thể tích cuối cùng là 200ml. Để dung dịch trong chai tối màu qua đêm, sau đó lọc lấy phần dung dịch trong, bảo quản trong chai tối màu có nút nhám. Tiến hành: 2ml dung dịch Nessler vào 25ml dung dịch mẫu nghiên cứu (hoặc pha loãng mẫu được với nồng độ thích hợp) và khuấy đều, để yên 15 phút. Sau đó định lượng amoni bằng cách đo độ hấp thụ ở A420 trên máy quang phổ kế. Dựng đồ thị chuẩn biểu diễn sự tương quan giữa độ hấp thụ ánh sáng và nồng độ amoni từ dung dịch chuẩn N-NH4 1g/l (Sigma) với các nồng độ: 1; 2; 3; 4; 5; 6 mg/l. Dựa trên đồ thị chuẩn để xác định hàm lượng amoni trong mẫu. Phụ lục 15 Định lượng NO2- theo phương pháp Griss Hàm lượng NO2- được xác định dựa trên phản ứng tạo màu hồng của NO2- với thuốc thử Griss . Thuốc thử: Griss I: Hoà tan 0,5g axit sunfanilic vào 150 ml axit acetic 5N. Griss II: Hoà tan 0,5g α-Naphtylamin vào 50ml nước cất, bổ sung 150 ml axit acetic 5N. Bảo quản trong tủ lạnh. Tiến hành: Thêm 0,05ml Griss I và 0,05ml Griss II vào 5 ml dung dịch mẫu nghiên cứu, sau 10 phút phản ứng kết thúc đo độ hấp thụ ở A520. Cường độ mầu tỷ lệ thuận với nồng độ nitrit. Lượng nitrit có trong mẫu nghiên cứu tính được dựa vào đồ thị chuẩn sử dụng dung dịch N-NO2 5mg/l

Các file đính kèm theo tài liệu này:

  • pdfluan_an_nghien_cuu_ung_dung_vi_khuan_tia_quang_hop_du_xu_ly.pdf
Luận văn liên quan