Luận án Nghiên cứu vai trò của một số gốc axit amin đối với tính chất của beta - Galactosidase từ bacillus subtilis VTCC - DVN - 12 - 01 phân lập ở Việt Nam bằng kỹ thuật ep - RCA và đột biến điểm định hướng

Plasmid pELacA amplified by the rolling circle mechanism in the presence of manganese ions had a size range of more than 10000 bp, which was multimeric forms of two or more repeated sequences of pELacA (7500 bp, monomeric form). The epRCA products were digested with a single-cut restriction enzyme MluI followed by self-ligation by treatment with T4 DNA ligase which dramatically increased the transformation efficiency 116 folds higher than that of direct transformation of the epRCA products without digestion and ligation. The maximum mutation frequency was 2.72.1 mutations/kb in epRCA supplemented with 1.5 mM of manganese chloride. The direction of the mutations was biased in favor of C to T (44.7%) and G to A (26.3%)

pdf168 trang | Chia sẻ: tueminh09 | Lượt xem: 988 | Lượt tải: 0Freedownload
Bạn đang xem trước 20 trang tài liệu Luận án Nghiên cứu vai trò của một số gốc axit amin đối với tính chất của beta - Galactosidase từ bacillus subtilis VTCC - DVN - 12 - 01 phân lập ở Việt Nam bằng kỹ thuật ep - RCA và đột biến điểm định hướng, để xem tài liệu hoàn chỉnh bạn click vào nút DOWNLOAD ở trên
MR and Buckeridge MS (1995) Changes in extracellular β-galactosidase and protease activities during bean hypocotyl growth. Braz J Plant Physiol, 7: 1-6. 30. Griffith KL and Wolf RE, Jr. (2002) Measuring beta-galactosidase activity in bacteria: cell growth, permeabilization, and enzyme assays in 96-well arrays. Biochem Biophys Res Commun, 290: 397-402. 31. Grosová Z, Rosenberg M, Gdovin M, Sláviková L and Rebroš M (2009) Production of d-galactose using β-galactosidase and Saccharomyces cerevisiae entrapped in poly(vinylalcohol) hydrogel. Food Chem, 116: 96–100. 124 32. Guimaraes P, Klein J, Domingues L and Teixeira JA (2005) Fermentation performance of a recombinant lactose-consuming flocculating Saccharomyces cerevisiae strain. Braz J Food Technol: 34-39. 33. Hahn-Hägerdal B (1985) Comparison between immobilized Kluyveromyces fragilis and Saccharomyces cerevisiae coimmobilized with β-galactosidase, with respect to continuous ethanol production from concentrated whey permeate. Biotechnol Bioeng, 27: 914–6. 34. Hansen T, Anderson M, Wehtje E and Adlercreutz P (2001) Influence of water activity on the competition between beta-galactooligosidase - catalysed transglycolysation and hydrolysis. Enzyme Microb Technol, 21: 527-534. 35. Henrissat B (1991) A classification of glycosyl hydrolases based on amino-acid sequence similarities. J Biochem, 280: 309–316. 36. Hidaka M, Fushinobu S, Ohtsu N, Motoshima H, Matsuzawa H, Shoun H and Wakagi T (2002) Trimeric crystal structure of the glycoside hydrolase family 42 beta-galactosidase from Thermus thermophilus A4 and the structure of its complex with galactose. J Mol Biol, 322: 79-91. 37. Hildebrandt P, Wanarska M and Kur J (2009) A new cold-adapted beta-D- galactosidase from the Antarctic Arthrobacter sp 32c-gene cloning, overexpression, purification and properties. BMC Microbiol, 9: 151. 38. Hoyoux A, Jennes I, Dubois P, Genicot S, Dubail F, Francois JM, Baise E, Feller G and Gerday C (2001) Cold-adapted beta-galactosidase from the Antarctic psychrophile Pseudoalteromonas haloplanktis. Appl Environ Microbiol, 67: 1529-35. 39. Hsu CA, Lee SL and Chou CC (2007) Enzymatic production of galacto- oligosaccharides by β-galactoseidase from Bifidobacterium longum BCRC 15708. J Agric Food Chem, 55: 2225-2230. 40. Iqbal S, Nguyen TH, Nguyen TT, Maischberger T and Haltrich D (2010) beta- Galactosidase from Lactobacillus plantarum WCFS1: biochemical characterization and formation of prebiotic galacto-oligosaccharides. Carbohydr Res, 345: 1408-16. 41. Ishikawa K, Kataoka M, Yanamoto T, Nakabayashi M, Watanabe M, Ishihara S and Yamaguchi S (2015) Crystal structure of beta-galactosidase from Bacillus circulans ATCC 31382 (BgaD) and the construction of the thermophilic mutants. Febs J, 282: 2540-52. 42. Jacobson RH, Zhang XJ, DuBose RF and Matthews BW (1994) Three- dimensional structure of β-galactosidase from E. coli. Nature, 369: 761-6. 43. Järvelä I, Torniainen S and Kolho KL (2009) Molecular genetics of human lactase deficiencies. Ann Med, 41: 568–75. 44. Jenkins J, Lo Leggio L, Harris G and Pickersgill R (1995) Beta-glucosidase, beta-galactosidase, family A cellulases, family F xylanases and two barley 125 glycanases form a superfamily of enzymes with 8-fold beta/alpha architecture and with two conserved glutamates near the carboxy-terminal ends of beta- strands four and seven. FEBS Lett, 362: 281-285. 45. Johansen AG, Vegarud GE and Skeie S (2002) Seasonal and regional variation in the composition of whey from Norwegian Cheddar-type and Dutch-type cheese. Inter Dairy J, 12: 621-629. 46. Juers DH (2000) A structural view of beta-galactosidase in action. Dean of the Graduate School. 47. Juers DH, Heightman TD, Vasella A, McCarter JD, Mackenzie L, Withers SG and Matthews BW (2001) A structural view of the action of Escherichia coli (lacZ) beta-galactosidase. Biochemistry 40: 14781-94. 48. Jung SJ and Lee BH (2008) Production and application of galacto- oligosaccharides from lactose by a recombinant β-galactosidase of Bifidobacterium infantis overproduced by Pichia pastoris. Food Sci Biotechnol, 17: 514-518. 49. Kang SK, Cho KK, Ahn JK, Bok JD, Kang SH, Woo JH, Lee HG, You SK and Choi YJ (2005a) Three forms of thermostable lactose-hydrolase from Thermus sp. IB-21: cloning, expression, and enzyme characterization. J Biotechnol, 116: 337-46. 50. Kang SK, Cho KK, Ahn JK, Bok JD, Kang SH, Woo JH, Lee HG, You SK and Choi YJ (2005b) Three forms of thermostable lactose-hydrolase from Thermus sp.IB-21: Cloning, expression, and enzyme characterization. J Biotechnol, 116: 337-346. 51. Kaur J and Sharma R (2006) Directed evolution: an approach to engineer enzymes. Crit Rev Biotechnol, 26: 165-199. 52. Kelley LA, Mezulis S, Yates CM, Wass MN and Sternberg MJE (2015) The Phyre2 web portal for protein modeling, prediction and analysis. Nature Protocols, 10: 845-858. 53. Kim CS, Ji ES and Oh DK (2004) Characterization of a thermostable recombinant beta-galactosidase from Thermotoga maritima. J Appl Microbiol, 97: 1006-14. 54. Kim WD, Kaneko S, Park GG, Tanaka H, Kusakabe I and Kobayashi H (2003) Purification and characterization of β-galactosidase from sunflower seeds. Biotechnol Lett, 25: 353–358. 55. Kobayashi T, Liu D, Ogawa H, Miwa Y, Nagasaka T, Maruyama S, Li YT, Onishi A, Iwamoto M, Kuzuya T, Kadomatsu K, Uchida K and Nakao A (2009) Removal of blood group A/B antigen in organs by ex vivo and in vivo administration of endo-beta-galactosidase (ABase) for ABO-incompatible transplantation. Transpl Immunol, 20: 132-8. 56. Kotake T, Dina S, Konishi T, Kaneko S, Igarashi K, Samejima M, Watanabe Y, Kimura K and Tsumuraya Y (2005) Molecular cloning of a β-galactosidase 126 from radish that specifically hydrolyzes β-1,3- and β-1,6-galactosyl residues of arabinogalactan protein. Plant Physiol Biochem, 138: 1563-1576. 57. Lewandowska M and Kujawski W (2007) Ethanol production from lactose in a fermentation/pervaporation system. J Food Eng, 79: 430–7. 58. Li Y, Lu L, Wang H, Xu X and Xiao M (2009a) Cell surface engineering of a β- galactosidase for galactooligosaccharide synthesis. Appl Environ Microbiol, 75: 5938-42. 59. Li Y, Wang H, Lu L, Li Z, Xu X and Xiao M (2009b) Purification and characterization of a novel beta-galactosidase with transglycosylation activity from Bacillus megaterium 2-37-4-1. Appl Biochem Biotechnol, 158: 192-9. 60. Liu W, Bevan DR and Zhang YH (2010) The family 1 glycoside hydrolase from Clostridium cellulolyticum H10 is a cellodextrin glucohydrolase. Appl Biochem Biotechnol, 161: 264-73. 61. Liu WY, Shi YW, Wang XQ, Wang Y, Wei CQ and Lou K (2008) Isolation and Identification of a strain producing cold-adapted β-galactosidase, and purification and characterisation of the enzyme. Czech J Food Sci, 26: 284–290. 62. Lu L, Xiao M, Li Z, Li Y and Wang F (2009) A novel transglycosylating β- galactosidase from Enterobacter cloacae B5. Process Biochem, 44: 232-236. 63. Maciuńska J, Czyz B and Synowiecki J (1998) Isolation and some properties of β-galactosidase from the thermophilic bacterium Thermus thermophilus. Food Chem, 63: 441-445. 64. Mahoney RR (1998) Galactosyl-oligasaccharide formation during lactose hydrolysis: a review. Food Chem, 63: 147-154. 65. Maksimainen M, Hakulinen N, Kallio JM, Timoharju T, Turunen O and Rouvinen J (2011) Crystal structures of Trichoderma reesei beta-galactosidase reveal conformational changes in the active site. J Struct Biol, 174: 156-63. 66. Maksimainen M, Paavilainen S, Hakulinen N and Rouvinen J (2012) Structural analysis, enzymatic characterization, and catalytic mechanisms of β- galactosidase from Bacillus circulans sp. alkalophilus. FEBS J, 279: 1788-98. 67. Maldonado J, Gil A, Narbona E and Molina JA (1998) Special formulas in infant nutrition: a review. Early Hum Dev, 53 Suppl: S23-32. 68. Mantei N, Villa M, Enzler T, Wacker H, Boll W, James P, Hunziker W and Semenza G (1988) Complete primary structure of human and rabbit lactase- phlorizin hydrolase: implications for biosynthesis, membrane anchoring and evolution of the enzyme. Embo J, 7: 2705-13. 69. Mariotti MP, Yamanaka H, Araujo AR and Trevisan HC (2008) Hydrolysis of whey lactose by immobilized β-galactosidase. Braz Arch Biol Technol, 51: 1233-1240. 70. Marrakchi M, Dzyadevych SV, Lagarde F, Martelet C and Jaffrezic-Renault N (2008) Conductometric biosensor based on glucose oxidase and beta- 127 galactosidase for specific lactose determination in milk. Mater Sci Eng, 28: 872-875. 71. Matthews BW (2005) The structure of E. coli beta-galactosidase. C R Biol, 328: 549-556. 72. McCarter JD, Burgoyne DL, Miao S, Zhang S, Callahan JW and Withers SG (1997) Identification of Glu-268 as the catalytic nucleophile of human lysosomal beta-galactosidase precursor by mass spectrometry. J Biol Chem, 272: 396-400. 73. Michová Z and Rosenberg M (2006) Current trends of β-galactosidase application in food technology. J Food Nutr Res, 45: 47-54. 74. Miller JH (1972) Experiments in Molecular Genetics. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY. 75. Nakagawa T, Ikehata R, Myoda T, Miyaji T and Tomizuka N (2007) Overexpression and functional analysis of cold-active beta-galactosidase from Arthrobacter psychrolactophilus strain F2. Protein Expr Purif, 54: 295-9. 76. Natarajan J, Christobell C, Mukesh Kumar DJ, Balakumaran MD, Ravi Kumar M and Kalaichelvan PT (2012) Isolation and characterization of beta- galactosidase producing Bacillus sp. from dairy effluent. World Appl Sci J, 17: 1466-1474. 77. Numanoglu Y and Sungur S (2004) β-Galactosidase from Kluyeromyces lactis cell disruption and enzyme immobilization using a cellulose-gelatin carrier system. Proc Biochem, 39: 703–709. 78. Ohto U, Usui K, Ochi T, Yuki K, Satow Y and Shimizu T (2012) Crystal structure of human β-galactosidase: structural basis of Gm1 gangliosidosis and morquio B diseases. J Biol Chem, 287: 1801–1812. 79. Panesar PS, Kumari S and Panesar R (2010) Potential applications of immobilized β-galactosidase in food processing industries. In: Enzyme Res 80. Parikh MR and Matsumura I (2005) Site-saturation mutagenesis is more efficient than DNA shuffling for the directed evolution of beta-fucosidase from beta-galactosidase. J Mol Biol, 352: 621-628. 81. Pereira-Rodríguez A, Fernández-Leiro R, González-Siso MI, Cerdán ME, Becerra M and Sanz-Aparicio J (2012) Structural basis of specificity in tetrameric Kluyveromyces lactis β-galactosidase J Struct Biol, 177: 392-401. 82. Placier G, Watzlawick H, Rabiller C and Mattes R (2009) Evolved β- Galactosidase from Geobacillus stearothermophilus with improved transgalactosylation yield for galacto-oligosaccharide production. Appl Environ Microbiol, 75: 6312-6321. 83. Quyen DT, Tran VG, Nguyen SLT, Nguyen TT and Vu VH (2011) Cloning, high-level expression and characterization of a β-galactosidase from Bacillus 128 subtilis G1. Aust J Basic Appl Sci, 5: 193-199. 84. Rakesh MK and Shobhana VB (2007) Purification of β-galactosidase from Erythrina indica: Involvement of tryptophan in active site. Biochim Biophys Acta, 1770: 1506–1512. 85. Richmond ML, Gray JI and Stine CM (1981) Beta-galactosidase: Review of recent research related to technological application, nutritional concerns, and immobilization. J Dairy Sci, 64: 1759-1 771. 86. Rojas AL, Nagem RA, Neustroev KN, Arand M, Adamska M, Eneyskaya EV, Kulminskaya AA, Garratt RC, Golubev AM and Polikarpov I (2004) Crystal structures of beta-galactosidase from Penicillium sp. and its complex with galactose. J Mol Biol, 343: 1281-92. 87. Rosenberg M, Tomaska M, Kanuch J and Sturdik E (1995) Improved ethanol production fromwhey with Saccharomyces cerevisiae using permeabilized cells of Kluyveromyces marxianus. Acta Biotechnol, 15: 387–90. 88. Ross GS, Redgwell RJ and MacRae EA (1993) Kiwifruit β-galactosidase: isolation and activity against specific fruit cell wall polysaccharides. Planta, 189: 499–506. 89. Roukas T LH (1991) Ethanol production from deproteinized whey by β- galactosidase coimmobilized cells of Saccharomyces cerevisiae. J Ind Microbiol, 7: 15–18. 90. Roy I and Gupta MN (2003) Lactose hydrolysis by LactozymTM immobilized on cellulose beads in batch and fluidized bed modes. Process Biochem, 39: 325-332. 91. Ryoo HJ, Yang EJ, Chung HY, Lee HJ, Kim JH, Chung DK, Lee JH and Chang HC (2002) Mg2+ ligands (Glu-384, Glu-429) of β-galactosidase from Lactococcus lactis spp. lactis 7962. J Biotechnol, 24: 691-696. 92. Sambrook J and Russell DW (2001) Molecular Cloning. A Laboratory Manual. 3rd edn. Cold Spring Harbor Laboratory, Cold Spring Harbor, NY. 93. Sánchez-Aparicio MT, Rosas MF, Ferraz RM, Delgui L, Veloso JJ, Blanco E, Villaverde A and Sobrino F (2009) Discriminating foot-and-mouth disease virus-infected and vaccinated animals by use of β-galactosidase allosteric biosensors. Clin Vaccine Immunol, 16: 1228-1235. 94. Schmidt M and Stougaard P (2010) Identification, cloning and expression of a cold-active beta-galactosidase from a novel Arctic bacterium, Alkalilactibacillus ikkense. Environ Technol, 31: 1107-14. 95. Shah NP, Spurgeon KR and Gilmore TM (1993) Use of dry whey and lactose hydrolysis in yoghurt bases. Milk Sci Int, 48: 494-498. 96. Sheridan PP and Brenchley JE (2000) Characterization of a salt-tolerant family 42 beta-galactosidase from a psychrophilic antarctic Planococcus isolate. Appl Environ Microbiol, 66: 2438-44. 129 97. Shumway MV and Sheridan PP (2012) Site-directed mutagenesis of a family 42 beta-galactosidase from an antarctic bacterium. Int J Biochem Mol Biol, 3: 209-218. 98. Skalova T, Dohnalek J, Spiwok V, Lipovova P, Vondrackova E, Petrokova H, Duskova J, Strnad H, Kralova B and Hasek J (2005) Cold-active beta- galactosidase from Arthrobacter sp. C2-2 forms compact 660 kDa hexamers: crystal structure at 1.9A resolution. J Mol Biol, 353: 282-294. 99. Smith DL and Gross KC (2000) A family of at least seven β-galactosidase genes is expressed during tomato fruit development. Plant Physiol Biochem, 123: 1173–1183. 100. Song J, Abe K, Imanaka H, Imamura K, Minoda M, Yamaguchi S and Nakanishi K (2011) Causes of the production of multiple forms of beta- galactosidase by Bacillus circulans. Biosci Biotechnol Biochem, 75: 268-78. 101. Staniszewski M, Kujawski W and M. L (2009) Semi-continuous ethanol production in bioreactor from whey with co-immobilized enzyme and yeast cells followed by pervaporative recovery of product - Kinetic model predictions considering glucose repression. J Food Eng, 91: 240–9. 102. Stepper J, Dabin J, Eklof JM, Thongpoo P, Kongsaeree P, Taylor EJ, Turkenburg JP, Brumer H and Davies GJ (2013) Structure and activity of the Streptococcus pyogenes family GH1 6-phospho-beta-glucosidase SPy1599. Acta Crystallogr D Biol Crystallogr, 69: 16-23. 103. Surzhik MA, Schmidt AE, Glazunov EA, Firsov DL and Petukhov MG (2014) Introduction of additional thiol groups into glucoamylase in Aspergillus Awamori and their effect on the thermal stability and catalytic activity of the enzyme. Appl Biochem Microbiol, 50: 118-124. 104. Taniguchi AY and Takano K (2004) Purification and properties of β- galactosidase from Tilapia intestine: digestive enzyme of Tilapia-X, Fish. Science, 70: 688-694. 105. Torres MJ and Lee BH (1995) Cloning and expression of β-galactosidase from psychotrophic Bacillus subtilis KL88 into Escherichia coli. Biotechnol Appl Biochem, 17: 123-128. 106. Vetere A and Paoletti S (1998) Separation and characterization of three beta- galactosidases from Bacillus circulans. Biochim Biophys Acta, 1380: 223-31. 107. Volkov IY, Lunina NA, Berezina OV, Velikodvorskaya GA and Zverlov VV (2005) Thermoanaerobacter ethanolicus gene cluster containing the α– and β- galactosidase genes melA and lacA and properties of recombinant LacA. Mol Biol, 39: 799–805. 108. Wafik SE, Kathleen MD and Antero GS (1984) Molecular mechanisms of manganese mutagenesis. Proc Natl Acad Sci USA, 18: 7378-7382. 109. Wallenfels K and Malhotra OP (1961) Galactosidases. Adv Carbohydr Chem, 16: 239–298. 130 110. Wang H, Luo H, Bai Y, Yang P, Shi P, Zhang W, Fan Y and Yao B (2009) An acidophilic β-galactosidase from Bispora sp. MEY-1 with high lactose hydrolytic activity under simulated gastric conditions. J Agric Food Chem, 57: 5535-5541. 111. Warmerdam A, Boom RM and Janssen AE (2013) β-galactosidase stability at high substrate concentrations. Springerplus, 2: 402. 112. Wass MN, Kelley LA and Sternberg MJ (2010) 3DLigandSite: predicting ligand-binding sites using similar structures. Nucleic Acids Res, 38: W469-73. 113. Wu Y, Yuan S, Chen S, Wu D, Chen J and Wu J (2013) Enhancing the production of galacto-oligosaccharides by mutagenesis of Sulfolobus solfataricus β-galactosidase. Food Chem, 138: 1588–1595. 114. Xiong AS, Peng RH, Zhuang J, Liu JG, Xu F, Cai B, Guo ZK, Qiao YS, Chen JM, Zhang Z and Yao QH (2007a) Directed evolution of β-galactosidase from Escherichia coli into β-glucuronidase. J Biochem Mol Biol, 40: 419-25. 115. Xiong AS, Peng RH, Zhuang J, Xian L, Xue Y, Liu JG, Gao F, Cai B, Chen JM and Yao QH (2007b) Directed evolution of a β-galactosidase from Pyrococcus woesei resulting in increased thermostable β-glucuronidase activity. Appl Microbiol Biotech, 77: 569-578. 116. Yu L and O'Sullivan DJ (2014) Production of galactooligosaccharides using a hyperthermophilic β-galactosidase in permeabilized whole cells of Lactococcus lactis. J Dairy Sci, 97: 694-703. 117. Yuan T, Yang P, Wang Y, Meng K, Luo H, Zhang W, Wu N, Fan Y and Yao B (2008) Heterologous expression of a gene encoding a thermostable beta- galactosidase from Alicyclobacillus acidocaldarius. Biotechnol Lett, 30: 343-8. 118. Zang JH, Dawes G and Stemme WPC (1997) Directed evolution of a fucosidase from a galactosidase by DNA shuffling and screening. Proc Natl Acad Sci USA, 94: 4504–4509. 119. Zhou QZK and Chen XD (2001) Effects of temperature and pH on the catalytic activity of the immobilized β-galactosidase from Klyveromyces lactic. J Biochem Engine, 9: 33-40. Trang Web 1. 2. 3. 4. 1 PHỤ LỤC Phụ lục 1. Trình tự nucleotide thay đổi tại vị trí 120 trên gene lacA của một số dòng đột biến Phụ lục 2. Trình tự nucleotide thay đổi tại vị trí W331 trên gen lacA của một số dòng đột biến 2 Wild-type Phe361Val Phụ lục 3. Trình tự nucleotide thay đổi tại vị trí 361 trên gen lacA Phụ lục 4. Trình tự nucleotide thay đổi tại vị trí 371, 373 và 374 của một số dòng đột biến Phe361 3 Phụ lục 5. Hoạt tính đặc hiệu của LacA ban đầu và LacA đột biến với cơ chất oNPG Dòng đột biến LacA đột biến OD 420 nm Hoạt tính riêng (IU/mg) Hoạt tính trung bình (IU/mg) Lần 1 Lần 2 Lần 3 Lần 1 Lần 2 Lần 3 WT 1,68 1,71 1,63 2,49 2,53 2,41 2,48  0,06 2.461 Glu62Val 1,58 1,64 1,61 2,34 2,43 2,39 2,39  0,045 Arg77Trp 1,78 1,69 1,72 2,64 2,50 2,55 2,56  0,068 Aal191Val 1,66 1,74 1,65 2,46 2,58 2,44 2,49  0,073 Ala301Val 0,386 0,404 0,399 0,57 0,60 0,59 0,59  0,014 3.259 Phe361Tyr 0,75 0,69 0,79 1,11 1,02 1,17 1,11  0,075 Ala429Val 1,65 1,59 1,67 2,44 2,35 2,46 2,41  0,058 Ala524Thr 1,75 1,73 1,65 2,59 2,56 2,44 2,53  0,078 Phụ lục 6. Nhiệt độ hoạt động tối ưu của LacA-WT và các LacA đột biến Nhiệt độ (C) Hoạt tính của LacA-WT và các LacA đột biến (IU/mg) WT Ala301 Glu Ala301 Val Ala301 Tyr Phe361 Tyr Leu373 Cys Leu373 Met 30 0,653  0,042 0,251  0,013 0,178  0,005 0,271  0,012 0,339  0,018 0,368  0,009 0,709  0,006 35 0,933  0,021 0,521  0,012 0,340  0,010 0,471  0,012 0,481  0,036 0,594  0,013 1,213  0,045 40 1,542  0,056 0,775  0,022 0,391  0,010 0,625  0,022 0,670  0,019 0,735  0,028 1,503  0,040 45 2,164  0,062 0,787  0,033 0,528  0,035 0,737  0,033 0,799  0,026 0,753  0,018 1,685  0,012 50 2,451  0,024 1,123  0,054 0,589  0,057 0,954  0,052 0,849  0,020 0,775  0,014 1,847  0,051 55 2,568  0,053 1,004  0,052 0,659  0,010 1,073  0,054 1,049  0,031 0,821  0,018 1,988  0,088 60 0,847  0,006 0,602  0,053 0,474  0,031 0,616  0,026 0,386  0,015 0,810  0,002 1,400  0,047 65 0,547  0,042 0,499  0,055 0,041  0,004 0,397  0,045 0,327  0,006 0,403  0,005 0,630  0,013 70 0,310  0,019 0,190  0,020 0,041  0,002 0,155  0,007 0,258  0,014 0,403  0,007 0,530  0,030 75 0,244  0,010 0,074  0,010 0,034  0,001 0,084  0,007 0,215  0,015 0,417  0,024 0,460  0,033 4 Phụ lục 7. pH hoạt động tối ưu của LacA-WT và các LacA đột biến pH Hoạt tính của LacA-WT và các LacA đột biến (IU/mg) WT Ala301 Glu Ala301 Val Ala301 Tyr Phe361 Tyr Leu373 Cys Leu373 Met 4 0,168  0,003 0,010  0,002 0,000  0,002 0,009  0,005 0,173  0,009 0,162  0,001 0,238  0,01 4,5 0,213  0,008 0,012  0,001 0,000  0,001 0,010  0,065 0,194  0,011 0,198  0,005 0,245  0,00 5 0,930  0,024 0,418  0,005 0,010  0,006 0,195  0,054 0,379  0,015 0,310  0,004 0,758  0,01 5,5 1,990  0,016 0,874  0,006 0,412  0,013 0,743  0,088 0,831  0,011 0,605  0,068 1,636  0,01 6 2,320  0,032 1,208  0,009 0,434  0,012 1,074  0,092 0,887  0,021 0,791  0,031 1,838  0,05 6 2,129  0,081 1,116  0,026 0,426  0,003 0,955  0,009 0,854  0,065 0,693  0,052 1,742  0,12 6,5 2,424  0,129 1,310  0,025 0,537  0,001 1,164  0,035 1,100  0,008 0,870  0,085 1,856  0,09 7 2,229  0,078 1,177  0,072 0,471  0,008 0,920  0,032 0,884  0,006 0,655  0,008 1,343  0,13 7,5 1,734  0,048 0,629  0,031 0,381  0,001 0,520  0,031 0,719  0,005 0,521  0,109 1,054  0,02 8 1,291  0,020 0,167  0,000 0,201  0,001 0,148  0,003 0,660  0,016 0,451  0,013 0,814  0,07 8 0,949  0,042 0,308  0,016 0,131  0,001 0,274  0,026 0,445  0,005 0,382  0,007 0,724  0,06 8,5 0,580  0,014 0,031  0,016 0,059  0,001 0,027  0,065 0,232  0,004 0,272  0,034 0,432  0,01 9 0,339  0,005 0,013  0,002 0,013  0,000 0,012  0,096 0,217  0,004 0,237  0,019 0,291  0,01 5 Phụ lục 8. Độ bền pH của LacA-WT pH Thời gian (giờ) Hoạt tính của LacA-WT (IU/mg) pH Hoạt tính của LacA-WT (IU/mg) Lần 1 Lần 2 Lần 3 Hoạt tính còn lại (%) Lần 1 Lần 2 Lần 3 Hoạt tính còn lại (%) 4 0 2,58 2,61 2,52 100 7 2,67 2,64 2,75 100 6 1,54 1,58 1,47 57,1  2,10 2,57 2,52 2,63 96,1  2,1 12 0,95 0,84 1,04 35,1  3,77 2,47 2,44 2,59 93,3  3,1 24 0,86 0,97 0,83 32,6  2,73 2,50 2,43 2,39 94,6  2,3 48 0,61 0,56 0,65 22,9  1,73 2,46 2,61 2,44 92,2  3,4 72 0,55 0,58 0,59 21,9  0,77 2,37 2,27 2,53 90,1  5,0 5 0 2,64 2,75 2,68 100 8 2,64 2,67 2,68 100 6 2,47 2,59 2,56 94,8  2,3 2,50 2,57 2,58 95,2  1,7 12 2,37 2,49 2,54 92,2  3,2 2,39 2,47 2,60 92,8  3,9 24 2,33 2,41 2,52 93,9  3,7 2,40 2,32 2,24 90,0  3,1 48 2,62 2,45 2,40 91,7  4,1 2,43 2,55 2,37 90,3  3,4 72 2,29 2,42 2,45 90,1 3,3 2,44 2,39 2,48 91,9  1,7 6 0 2,69 2,52 2,62 100 9 2,62 2,68 2,52 100 6 2,62 2,55 2,46 95,1  3,0 2,48 2,53 2,58 94,5  2,0 12 2,42 2,60 2,57 94,4  3,6 2,47 2,41 2,50 91,7  1,8 24 2,37 2,28 2,49 92,3  4,2 2,36 2,23 2,44 90,8  4,2 48 2,34 2,44 2,51 89,5  3,2 2,50 2,39 2,40 89,5  2,2 72 2,52 2,42 2,35 91,7  3,3 2,21 2,33 2,41 87,4  3,8 6 Phụ lục 9. Độ bền pH của LacA đột biến Ala301Glu pH Thời gian (giờ) Hoạt tính của LacA-301Glu (IU/mg) pH Hoạt tính của LacA-301Glu (IU/mg) Lần 1 Lần 2 Lần 3 Hoạt tính còn lại (%) Lần 1 Lần 2 Lần 3 Hoạt tính còn lại (%) 4 0 1,42 1,50 1,55 100 7 1,57 1,63 1,50 100 6 0,58 0,62 0,53 41,5  3,2 1,24 1,28 1,36 92,7  4,2 12 0,44 0,39 0,47 27,4  2,4 1,51 1,38 1,46 91,1  4,0 24 0,24 0,27 0,24 16,2  0,9 1,41 1,46 1,37 91,6  2,9 48 0,21 0,21 0,19 12,3  0,6 1,54 1,37 1,42 87,1  5,1 72 0,19 0,19 0,19 12,8  0,2 1,31 1,36 1,23 88,2  4,3 5 0 1,51 1,57 1,61 100 8 1,61 1,67 1,58 100 6 1,36 1,28 1,16 90,6  7,3 1,30 1,33 1,26 92,8  2,7 12 1,37 1,46 1,51 90,8  4,4 1,51 1,51 1,39 92,1  4,4 24 1,32 1,42 1,36 88,6  3,3 1,39 1,27 1,42 88,1  5,4 48 1,47 1,35 1,41 85,1  3,8 1,49 1,45 1,51 89,5  1,9 72 1,35 1,26 1,17 85,3  6,0 1,25 1,29 1,31 86,9  2,1 6 0 1,54 1,46 1,59 100 9 1,64 1,55 1,59 100 6 1,36 1,24 1,28 92,7  4,2 1,25 1,30 1,24 90,5  2,1 12 1,41 1,52 1,49 92,4  3,7 1,50 1,53 1,39 92,2  4,7 24 1,46 1,37 1,33 90,0  4,2 1,31 1,40 1,37 88,0  2,9 48 1,50 1,40 1,38 86,1  3,8 1,41 1,42 1,49 86,9  2,4 72 1,32 1,24 1,21 85,3  4,0 1,27 1,14 1,25 82,7  4,8 7 Phụ lục 10. Độ bền pH của LacA đột biến Ala301Tyr pH Thời gian (giờ) Hoạt tính của LacA-301Tyr (IU/mg) pH Hoạt tính của LacA-301Tyr (IU/mg) Lần 1 Lần 2 Lần 3 Hoạt tính còn lại (%) Lần 1 Lần 2 Lần 3 Hoạt tính còn lại (%) 4 0 1,13 1,22 1,18 100 7 1,57 1,53 1,46 100 6 0,53 0,51 0,49 43,5  1,4 1,43 1,38 1,40 92,6  1,8 12 0,42 0,39 0,38 33,2  1,6 1,50 1,39 1,44 93,3  3,5 24 0,26 0,23 0,27 20,4  1,6 1,45 1,42 1,47 90,8  1,5 48 0,15 0,18 0,18 14,6  1,2 1,41 1,26 1,43 90,7  6,3 72 0,15 0,17 0,14 12,7  1,5 1,39 1,30 1,37 86,0  3,0 5 0 1,46 1,57 1,59 100 8 1,57 1,51 1,46 100 6 1,31 1,36 1,41 90,0  3,4 1,37 1,43 1,44 93,6  2,4 12 1,39 1,32 1,31 86,7  2,6 1,41 1,38 1,34 89,2  2,2 24 1,42 1,38 1,32 86,4  3,1 1,45 1,39 1,38 88,3  2,3 48 1,31 1,25 1,26 84,3  2,1 1,41 1,34 1,31 89,8  3,3 72 1,38 1,26 1,37 84,9  4,3 1,30 1,35 1,31 84,1  1,8 6 0 1,53 1,61 1,59 100 9 1,47 1,51 1,54 100 6 1,41 1,40 1,46 94,0  2,2 1,40 1,38 1,30 90,0  3,7 12 1,43 1,39 1,48 92,7  3,1 1,41 1,41 1,27 88,1  5,3 24 1,40 1,50 1,49 91,7  3,6 1,44 1,37 1,39 87,8  2,3 48 1,38 1,26 1,40 89,6  5,0 1,37 1,31 1,26 87,1  3,8 72 1,36 1,28 1,23 82,3  4,1 1,34 1,28 1,33 84,0  1,9 8 Phụ lục 11. Độ bền pH của LacA đột biến Ala301Val pH Thời gian (giờ) Hoạt tính của LacA-301Val (IU/mg) pH Hoạt tính của LacA-301Val (IU/mg) Lần 1 Lần 2 Lần 3 Hoạt tính còn lại (%) Lần 1 Lần 2 Lần 3 Hoạt tính còn lại (%) 4 0 0,85 0,89 0,78 100 7 0,87 0,88 0,90 100 6 0,46 0,38 0,41 46,3  4,3 0,87 0,84 0,85 95,1  2,1 12 0,40 0,42 0,37 45,5  2,9 0,84 0,82 0,84 96,0  1,1 24 0,25 0,27 0,24 29,9  1,5 0,77 0,80 0,83 94,7  3,6 48 0,10 0,12 0,11 12,6  0,7 0,85 0,81 0,82 94,1  2,4 72 0,05 0,05 0,06 6,9  0,7 0,75 0,71 0,73 92,9  2,5 5 0 0,83 0,88 0,87 100 8 0,87 0,90 0,85 100 6 0,85 0,79 0,84 92,3  3,7 0,87 0,83 0,82 94,3  2,9 12 0,81 0,77 0,78 90,7  2,7 0,83 0,81 0,78 92,7  2,9 24 0,81 0,75 0,78 91,6  3,6 0,80 0,76 0,79 92,0  2,2 48 0,77 0,74 0,76 85,9  2,2 0,82 0,85 0,79 93,2  3,3 72 0,68 0,70 0,65 86,3  3,2 0,74 0,70 0,71 91,0  2,5 6 0 0,78 0,83 0,87 100 9 0,90 0,87 0,88 100 6 0,81 0,85 0,88 94,6  3,6 0,79 0,81 0,84 90,4  2,8 12 0,84 0,79 0,81 93,9  3,0 0,83 0,79 0,78 92,0  2,9 24 0,79 0,83 0,78 94,3  3,3 0,81 0,76 0,75 90,9  3,6 48 0,79 0,82 0,83 92,2  2,4 0,82 0,81 0,75 89,7  4,3 72 0,74 0,73 0,70 92,0  2,8 0,73 0,70 0,69 90,2  3,0 9 Phụ lục 12. Độ bền pH của LacA đột biến Phe361Tyr pH Thời gian (giờ) Hoạt tính của LacA-361Tyr (IU/mg) pH Hoạt tính của LacA-361Tyr (IU/mg) Lần 1 Lần 2 Lần 3 Hoạt tính còn lại (%) Lần 1 Lần 2 Lần 3 Hoạt tính còn lại (%) 4 0 0,98 1,11 0,96 100 7 1,34 1,41 1,36 100 6 0,44 0,45 0,39 43,2  3,1 1,27 1,28 1,35 96,3  3,1 12 0,38 0,39 0,33 32,2  2,6 1,30 1,39 1,35 93,4  3,3 24 0,21 0,19 0,25 18,9  2,6 1,26 1,29 1,32 94,0  1,9 48 0,05 0,05 0,05 5,2  0,2 1,24 1,32 1,24 93,6  3,5 72 0,01 0,03 0,02 1,9  0,9 1,24 1,26 1,32 93,5  3,2 5 0 1,35 1,35 1,37 100 8 1,49 1,38 1,41 100 6 1,25 1,22 1,24 91,7  1,3 1,24 1,26 1,28 93,5  1,4 12 1,25 1,30 1,24 87,7  1,9 1,31 1,37 1,28 91,7  3,2 24 1,18 1,23 1,20 87,8  2,0 1,26 1,27 1,27 92,4  0,5 48 1,20 1,16 1,15 86,2  2,1 1,20 1,23 1,25 90,6  1,8 72 1,14 1,20 1,16 85,5  2,0 1,17 1,19 1,15 85,8  1,8 6 0 1,30 1,41 1,37 100 9 1,39 1,41 1,33 100 6 1,24 1,26 1,28 93,4  1,6 1,23 1,19 1,25 90,5  2,1 12 1,23 1,35 1,24 88,3  4,4 1,26 1,37 1,26 90,0  4,5 24 1,23 1,20 1,17 87,6  2,0 1,24 1,21 1,25 90,0  1,3 48 1,18 1,18 1,21 87,9  1,2 1,19 1,17 1,20 87,5  1,1 72 1,16 1,18 1,19 86,2  1,3 1,19 1,16 1,15 85,6  1,7 10 Phụ lục 13. Độ bền pH của LacA đột biến Leu373Cys pH Thời gian (giờ) Hoạt tính của LacA-373Cys (IU/mg) pH Hoạt tính của LacA-373Cys (IU/mg) Lần 1 Lần 2 Lần 3 Hoạt tính còn lại (%) Lần 1 Lần 2 Lần 3 Hoạt tính còn lại (%) 4 0 0,99 0,96 0,91 100 7 0,98 0,96 0,95 100 6 0,43 0,44 0,41 43,7  1,8 0,92 0,91 0,94 94,3  1,4 12 0,36 0,39 0,35 39,2  2,0 0,89 0,91 0,87 94,9  1,7 24 0,21 0,21 0,23 22,7  1,3 0,90 0,88 0,92 93,1  2,3 48 0,15 0,17 0,15 17,2  1,5 0,86 0,79 0,83 90,2  3,4 72 0,13 0,17 0,17 17,1  2,6 0,83 0,80 0,85 89,3  2,9 5 0 0,93 0,97 0,89 100 8 0,98 0,95 0,90 100 6 0,92 0,87 0,91 92,2  2,5 0,94 0,90 0,89 93,0  2,9 12 0,86 0,79 0,85 89,0  3,7 0,89 0,89 0,83 92,9  3,6 24 0,92 0,88 0,85 91,3  3,8 0,90 0,87 0,92 92,6  2,9 48 0,73 0,77 0,80 83,8  3,9 0,85 0,79 0,81 88,9  3,6 72 0,82 0,72 0,76 82,8  5,2 0,84 0,75 0,77 85,1  4,7 6 0 0,94 0,92 0,97 100 9 0,92 0,89 0,95 100 6 0,95 0,89 0,90 93,5  3,3 0,90 0,88 0,86 90,0  2,4 12 0,89 0,83 0,85 91,6  3,4 0,85 0,81 0,85 89,3  2,6 24 0,90 0,86 0,88 90,8  2,2 0,89 0,87 0,86 90,3  1,8 48 0,86 0,78 0,82 89,3  4,2 0,83 0,80 0,82 89,0  1,7 72 0,84 0,79 0,75 86,1  5,0 0,79 0,75 0,83 85,1  4,3 11 Phụ lục 14. Độ bền pH của LacA đột biến Leu373Met pH Thời gian (giờ) Hoạt tính của LacA-373Met (IU/mg) pH Hoạt tính của LacA-373Met (IU/mg) Lần 1 Lần 2 Lần 3 Hoạt tính còn lại (%) Lần 1 Lần 2 Lần 3 Hoạt tính còn lại (%) 4 0 1,84 1,81 1,87 100 7 1,85 1,87 1,90 100 6 0,88 0,89 0,95 49,6  2,1 1,78 1,75 1,72 95,8  1,7 12 0,78 0,81 0,80 42,3  0,9 1,81 1,78 1,75 94,9  1,7 24 0,44 0,51 0,56 26,0  3,1 1,82 1,79 1,76 92,4  1,7 48 0,39 0,42 0,41 22,9  0,8 1,69 1,61 1,69 93,7  2,4 72 0,37 0,36 0,42 21,6  2,0 1,59 1,64 1,51 89,0  3,5 5 0 1,83 1,77 1,80 100 8 1,77 1,83 1,87 100 6 1,68 1,61 1,64 90,2  2,0 1,69 1,73 1,71 93,8 1,1 12 1,71 1,67 1,64 89,2  1,9 1,78 1,78 1,71 93,7  2,3 24 1,79 1,75 1,71 90,4  1,9 1,76 1,79 1,75 91,2  1,2 48 1,64 1,53 1,58 89,4  3,0 1,65 1,56 1,59 90,2  2,8 72 1,55 1,51 1,53 86,1  1,2 1,47 1,52 1,54 85,0  1,9 6 0 1,93 1,81 1,80 100 9 1,88 1,85 1,91 100 6 1,75 1,71 1,68 93,8  2,0 1,67 1,64 1,69 91,1  1,5 12 1,78 1,74 1,72 93,0  1,7 1,72 1,61 1,71 89,5  3,3 24 1,81 1,77 1,75 91,5  1,6 1,68 1,70 1,78 88,7  2,7 48 1,65 1,55 1,58 89,8  2,8 1,65 1,56 1,56 89,5  3,1 72 1,52 1,55 1,51 86,0  1,0 1,45 1,53 1,54 84,8  2,7 12 Phụ lục 15. Độ bền nhiệt của LacA-WT và các LacA đột biến ở 30 và 40C Mẫu Thời gian (giờ) 30C 40C Lần 1 Lần 2 Lần 3 Hoạt tính trung bình (IU/mg) Lần 1 Lần 2 Lần 3 Hoạt tính trung bình (IU/mg) WT 0 2,67 2,64 2,75 100 2,67 2,64 2,75 100 6 2,57 2,52 2,63 96,1  2,1 2,57 2,55 2,68 96,9  2,6 12 2,47 2,44 2,59 93,3  3,1 2,42 2,47 2,51 92,2  1,6 24 2,50 2,43 2,39 94,6  2,3 2,34 2,30 2,20 88,4  2,9 48 2,46 2,61 2,44 92,2  3,4 2,34 2,27 2,23 83,9  2,1 72 2,37 2,27 2,53 90,1  5,0 2,19 2,14 2,08 80,5  2,1 Ala301 Val 0 0,87 0,88 0,90 100 0,87 0,88 0,90 100 6 0,87 0,84 0,85 95,1  2,1 0,82 0,86 0,87 95,0  3,2 12 0,84 0,82 0,84 96,0  1,1 0,80 0,82 0,83 94,0  1,8 24 0,77 0,80 0,83 94,7  3,6 0,79 0,78 0,81 93,3  2,0 48 0,85 0,81 0,82 94,1  2,4 0,79 0,77 0,80 89,5  1,7 72 0,75 0,71 0,73 92,9  2,5 0,68 0,65 0,67 84,8  2,1 Ala301 Glu 0 1,57 1,63 1,50 100 1,57 1,63 1,50 100 16 1,24 1,28 1,36 92,7  4,2 1,31 1,37 1,26 93,9  4,1 12 1,51 1,38 1,46 91,1  4,0 1,52 1,42 1,49 92,7  3,2 24 1,41 1,46 1,37 91,6  2,9 1,33 1,40 1,27 86,4  4,1 48 1,54 1,37 1,42 87,1  5,1 1,42 1,32 1,38 83,0  3,1 72 1,31 1,36 1,23 88,2  4,3 1,24 1,13 1,17 80,2  4,0 Ala301 Tyr 0 1,57 1,53 1,46 100 1,57 1,53 1,46 100 6 1,43 1,38 1,40 92,6  1,8 1,42 1,36 1,46 93,5  3,4 12 1,50 1,39 1,44 93,3  3,5 1,45 1,49 1,38 93,1  3,3 24 1,45 1,42 1,47 90,8  1,5 1,37 1,30 1,38 84,8  3,0 48 1,41 1,26 1,43 90,7  6,3 1,32 1,22 1,27 84,3  3,4 72 1,39 1,30 1,37 86,0  3,0 1,30 1,32 1,23 81,7  2,9 Fhe361 Tyr 0 1,34 1,41 1,36 100 1,34 1,41 1,36 100 6 1,27 1,28 1,35 96,3  3,1 1,24 1,31 1,27 94,4  2,4 13 12 1,30 1,39 1,35 93,4  3,3 1,30 1,35 1,38 93,1  3,1 24 1,26 1,29 1,32 94,0  1,9 1,25 1,26 1,32 93,2  2,8 48 1,24 1,32 1,24 93,6  3,5 1,24 1,18 1,20 89,0  2,3 72 1,24 1,26 1,32 93,5  3,2 1,19 1,18 1,13 85,5  2,2 Leu373 Cys 0 0,98 0,96 0,95 100 0,98 0,96 0,95 100 6 0,92 0,91 0,94 94,3  1,4 0,95 0,92 0,91 94,9  2,1 12 0,89 0,91 0,87 94,9  1,7 0,90 0,88 0,86 93,9  1,9 24 0,90 0,88 0,92 93,1  2,3 0,89 0,90 0,86 91,5  2,1 48 0,86 0,79 0,83 90,2  3,4 0,80 0,76 0,75 84,1  3,2 72 0,83 0,80 0,85 89,3  2,9 0,75 0,72 0,79 81,4  3,9 Leu373 Met 0 1,85 1,87 1,90 100 1,85 1,87 1,90 100 6 1,78 1,75 1,72 95,8  1,7 1,79 1,77 1,74 96,8  1,5 12 1,81 1,78 1,75 94,9  1,7 1,79 1,70 1,75 93,0  2,3 24 1,82 1,79 1,76 92,4  1,7 1,75 1,71 1,61 87,3  3,6 48 1,69 1,61 1,69 93,7  2,4 1,55 1,46 1,48 84,5  2,7 72 1,59 1,64 1,51 89,0  3,5 1,38 1,41 1,46 79,9  2,1 14 Phụ lục 16. Độ bền nhiệt của LacA-WT ở các nồng độ cơ chất khác nhau Nồng độ cơ chất (%) Thời gian (giờ) 45C 50C Lần 1 Lần 2 Lần 3 Hoạt tính trung bình (IU/mg) Lần 1 Lần 2 Lần 3 Hoạt tính trung bình (IU/mg) 0 0 2,65 2,55 2,59 2,596  0,05 2,55 2,53 2,47 2,52  0,04 1 2,16 2,17 2,13 2,16  0,02 2 1,80 1,86 1,87 1,844  0,04 1,73 1,65 1,64 1,68  0,05 4 1,01 1,00 1,03 1,01  0,02 6 0,7 0,64 0,71 0,683  0,04 5 0 2,74 2,81 2,86 2,80  0,06 2,78 2,85 3,16 2,93  0,20 1 2,37 2,40 2,39 2,39  0,01 2 1,95 1,90 1,92 1,92  0,03 4 1,52 1,53 1,54 1,53  0,01 6 2,27 2,25 2,24 2,253  0,02 24 1,82 1,74 1,82 1,793  0,05 48 0,91 0,91 0,89 0,904  0,01 10 0 2,32 2,56 2,86 2,58  0,27 2,65 2,40 2,59 2,55  0,13 1 2,16 2,17 2,13 2,156  0,02 2 1,73 1,65 1,64 1,676  0,05 4 1,01 1,00 1,03 1,010  0,02 6 1,85 1,82 1,74 1,80  0,06 24 0,83 1,01 0,93 0,92  0,09 48 0,35 0,31 0,32 0,33  0,02 15 0 1,89 1,96 2,27 2,041  0,20 1,89 1,96 2,27 2,04  0,21 1 1,52 1,48 1,50 1,50  0,01 2 0,93 0,96 0,94 0,94  0,03 4 0,49 0,51 0,52 0,51  0,01 6 1,41 1,52 1,48 1,470  0,06 24 0,68 0,65 0,56 0,634  0,06 48 0,12 0,15 0,14 0,136  0,01 15 Phụ lục 17. Độ bền nhiệt của LacA-301Glu ở các nồng độ cơ chất khác nhau Nồng độ cơ chất (%) Thời gian (giờ) 45C 50C Lần 1 Lần 2 Lần 3 Hoạt tính trung bình (IU/mg) Lần 1 Lần 2 Lần 3 Hoạt tính trung bình (IU/mg) 0 0 1,05 0,99 0,97 1,00  0,04 0,96 1,05 1,01 1,01  0,05 1 0,35 0,33 0,34 0,17  0,01 2 0,73 0,80 0,79 0,78  0,04 0,10 0,09 0,09 0,05  0,00 6 0,44 0,51 0,43 0,46  0,05 0,00 0,00 0,00 0,00  0,00 12 0,20 0,21 0,19 0,20  0,01 18 0,08 0,09 0,10 0,09  0,01 5 0 1,05 0,99 1,08 1,04  0,05 1,24 1,26 1,22 1,24  0,02 1 0,51 0,49 0,50 0,50  0,01 2 0,14 0,12 0,13 0,13  0,01 6 0,63 0,67 0,62 0,64  0,02 24 0,12 0,10 0,12 0,11  0,01 48 0,00 0,00 0,00 0,00  0,00 10 0 1,00 1,03 1,00 1,01  0,02 1,24 1,26 1,22 1,24  0,02 1 0,48 0,49 0,47 0,48  0,01 2 0,11 0,12 0,11 0,11  0,00 6 0,54 0,58 0,53 0,55  0,02 24 0,09 0,08 0,10 0,09  0,01 48 0,00 0,00 0,00 0,00  0,00 15 0 0,91 1,12 1,09 1,04  0,11 1,24 1,26 1,22 1,24  0,02 1 0,41 0,42 0,44 0,42  0,01 2 0,08 0,08 0,07 0,08  0,00 6 0,63 0,67 0,53 0,61  0,07 24 0,08 0,07 0,08 0,08  0,00 48 0,00 0,00 0,00 0,00  0,00 16 Phụ lục 18. Độ bền nhiệt của LacA-301Val ở các nồng độ cơ chất khác nhau Nồng độ cơ chất (%) Thời gian (giờ) 45C 50C Lần 1 Lần 2 Lần 3 Hoạt tính trung bình (IU/mg) Lần 1 Lần 2 Lần 3 Hoạt tính trung bình (IU/mg) 0 0 0,53 0,51 0,44 0,49  0,05 0,50 0,50 0,53 0,51  0,01 1 0,16 0,15 0,15 0,15  0,01 2 0,44 0,45 0,45 0,44  0,01 0,04 0,05 0,03 0,04  0,01 6 0,29 0,31 0,30 0,30  0,01 0,00 0,00 0,00 0,00  0,00 12 0,19 0,19 0,20 0,19  0,00 18 0,09 0,08 0,08 0,08  0,00 5 0 0,64 0,71 0,60 0,65  0,06 1 0,31 0,30 0,36 0,32  0,03 2 0,54 0,51 0,56 0,54  0,03 0,15 0,13 0,15 0,14  0,01 4 0,03 0,02 0,03 0,02  0,00 6 0,42 0,41 0,44 0,42  0,01 24 0,05 0,05 0,05 0,05  0,00 10 0 0,69 0,73 0,74 0,72  0,03 0,56 0,63 0,67 0,62  0,06 1 0,22 0,28 0,25 0,25  0,03 2 0,59 0,56 0,60 0,58  0,02 0,11 0,13 0,10 0,11  0,01 4 0,02 0,02 0,02 0,02  0,00 6 0,48 0,47 0,47 0,47  0,00 24 0,08 0,08 0,07 0,08  0,00 15 0 0,81 0,76 0,78 0,78  0,03 0,67 0,69 0,49 0,62  0,11 1 0,22 0,19 0,21 0,21  0,02 2 0,57 0,59 0,63 0,60  0,03 0,09 0,08 0,08 0,08  0,00 4 0,00 0,00 0,00 0,00  0,00 6 0,51 0,49 0,50 0,50  0,01 24 0,07 0,07 0,07 0,07  0,00 17 Phụ lục 19. Độ bền nhiệt của LacA-301Tyr ở các nồng độ cơ chất khác nhau Nồng độ cơ chất (%) Thời gian (giờ) 45C 50C Lần 1 Lần 2 Lần 3 Hoạt tính trung bình (IU/mg) Lần 1 Lần 2 Lần 3 Hoạt tính trung bình (IU/mg) 0 0 0,80 0,91 1,08 0,93  0,14 0,36 0,40 0,41 0,39  0,03 1 0,18 0,17 0,17 0,18  0,01 2 0,79 0,72 0,72 0,74  0,04 0,09 0,08 0,08 0,09  0,01 6 0,35 0,37 0,36 0,36  0,01 0,00 0,00 0,00 0,00  0,00 12 0,12 0,12 0,12 0,12  0,00 18 0,00 0,00 0,00 0,00  0,00 5 0 0,50 0,52 0,50 0,51  0,01 1,02 0,98 0,97 0,99  0,03 1 0,55 0,54 0,57 0,55  0,02 2 0,27 0,26 0,27 0,26  0,01 6 0,36 0,33 0,31 0,33  0,02 24 0,03 0,03 0,03 0,03  0,00 48 0,00 0,00 0,00 0,00 0,00 10 0 0,52 0,49 0,54 0,52  0,02 1,02 0,97 0,96 0,98  0,03 1 0,46 0,47 0,48 0,47  0,01 2 0,15 0,16 0,16 0,16  0,01 6 0,32 0,30 0,31 0,31  0,01 24 0,03 0,02 0,03 0,03  0,00 48 0,00 0,00 0,00 0,00 0,00 15 0 0,48 0,50 0,45 0,47  0,02 0,96 0,94 0,99 0,96  0,03 1 0,44 0,45 0,46 0,45  0,01 2 0,16 0,15 0,16 0,16  0,00 6 0,31 0,30 0,31 0,31  0,01 24 0,02 0,02 0,02 0,02  0,00 48 0,00 0,00 0,00 0,00  0,00 18 Phụ lục 20. Độ bền nhiệt của LacA đột biến Phe361Tyr ở các nồng độ cơ chất khác nhau Nồng độ cơ chất (%) Thời gian (giờ) 45C 50C Lần 1 Lần 2 Lần 3 Hoạt tính trung bình (IU/mg) Lần 1 Lần 2 Lần 3 Hoạt tính trung bình (IU/mg) 0 0 0,98 1,11 1,16 1,09  0,09 1,05 0,99 1,12 1,05  0,06 1 0,93 0,93 0,92 0,93  0,01 2 0,76 0,80 0,81 0,79  0,03 6 0,94 1,00 1,01 0,99  0,05 0,62 0,60 0,59 0,60  0,02 12 1,06 1,10 1,04 1,07  0,03 0,28 0,30 0,29 0,29  0,01 24 1,13 1,09 1,19 1,12  0,02 48 1,01 1,01 0,96 0,99  0,03 72 0,63 0,64 0,65 0,64  0,01 96 0,28 0,29 0,30 0,29  0,01 120 0,05 0,07 0,05 0,06  0,01 5 0 2,11 192 2,21 2,08  0,15 1,45 1,52 1,38 1,45  0,07 1 1,27 1,29 1,28 1,28  0,01 2 1,15 1,19 1,20 1,18  0,03 6 2,08 2,10 2,28 2,15  0,11 0,71 0,68 0,70 0,70  0,01 24 1,97 1,86 1,89 1,91  0,06 48 1,90 2,00 1,92 1,94  0,06 72 1,48 1,46 1,57 1,50  0,06 96 1,04 0,97 1,01 1,00  0,03 120 0,75 0,80 0,78 0,78  0,03 10 0 1,99 1,91 2,01 1,97  0,06 1,39 1,56 1,36 1,44  0,11 1 1,29 1,28 1,23 1,27  0,03 2 1,24 1,23 1,16 1,21  0,04 6 1,95 2,00 2,05 2,00  0,05 0,76 0,77 0,75 0,76  0,01 24 1,91 1,95 1,88 1,91  0,03 48 1,56 1,69 1,66 1,64  0,07 72 1,12 1,28 1,17 1,19  0,08 19 96 0,81 0,88 0,74 0,81  0,07 120 0,48 0,52 0,54 0,52  0,03 15 0 1,88 1,95 1,90 1,91  0,03 1,52 1,46 1,37 1,45  0,08 1 1,29 1,32 1,32 1,31  0,02 2 1,20 1,20 1,18 1,19  0,01 6 1,87 1,81 1,84 1,84  0,03 0,71 0,72 0,70 0,71  0,01 24 1,88 1,86 1,90 1,88  0,02 48 1,59 1,68 1,69 1,65  0,06 72 1,07 1,18 1,12 1,12  0,06 96 0,80 0,75 0,83 0,79  0,04 120 0,52 0,57 0,54 0,55  0,02 20 Phụ lục 21. Độ bền nhiệt của LacA đột biến Leu373Cys ở các nồng độ cơ chất khác nhau Nồng độ cơ chất (%) Thời gian (giờ) 45C 50C Lần 1 Lần 2 Lần 3 Hoạt tính trung bình (IU/mg) Lần 1 Lần 2 Lần 3 Hoạt tính trung bình (IU/mg) 0 0 0,90 1,01 0,93 0,94  0,06 0,8 0,75 0,88 0,81  0,07 1 0,58 0,63 0,60 0,60  0,02 2 0,82 0,81 0,80 0,81  0,01 0,26 0,23 0,24 0,24  0,01 6 0,63 0,63 0,65 0,64  0,01 0,05 0,05 0,06 0,05  0,00 12 0,39 0,36 0,37 0,37  0,01 18 0,18 0,17 0,19 0,18  0,01 5 0 0,83 0,72 0,76 0,77  0,05 0,83 0,72 0,76 0,77  0,05 1 0,60 0,62 0,59 0,60  0,01 2 0,38 0,36 0,39 0,37  0,01 6 0,72 0,73 0,73 0,73  0,01 0,21 0,23 0,20 0,21  0,01 24 0,40 0,39 0,42 0,40  0,02 48 0,21 0,21 0,20 0,21  0,01 10 0 0,72 0,81 0,74 0,76  0,05 0,72 0,81 0,74 0,76  0,05 1 0,56 0,55 0,60 0,57  0,03 2 0,32 0,32 0,36 0,33  0,02 6 0,67 0,69 0,69 0,68  0,01 0,12 0,11 0,12 0,11  0,01 24 0,32 0,31 0,33 0,32  0,01 48 0,08 0,08 0,09 0,08  0,00 15 0 0,76 0,85 0,92 0,84  0,08 0,76 0,85 0,92 0,84  0,08 1 0,52 0,50 0,54 0,52  0,02 2 0,26 0,24 0,27 0,25  0,02 6 0,64 0,64 0,66 0,65  0,01 0,05 0,05 0,05 0,05  0,00 24 0,20 0,24 0,22 0,22  0,02 48 0,03 0,03 0,03 0,03  0,00 21 Phụ lục 22. Độ bền nhiệt của LacA đột biến Leu373Met ở các nồng độ cơ chất khác nhau Nồng độ cơ chất (%) Thời gian (giờ) 45C 50C Lần 1 Lần 2 Lần 3 Hoạt tính trung bình (IU/mg) Lần 1 Lần 2 Lần 3 Hoạt tính trung bình (IU/mg) 0 0 1,7 1,92 1,82 1,81  0,11 1,72 1,88 1,68 1,76  0,10 1 0,60 0,55 0,63 0,59  0,04 2 1,50 1,50 1,51 1,50  0,01 0,30 0,21 0,22 0,25  0,05 6 0,89 0,85 0,86 0,87  0,02 0,00 0,00 0,00 0,00  0,00 12 0,23 0,25 0,24 0,24  0,01 18 0,08 0,07 0,05 0,07  0,01 5 0 1,89 1,96 1,83 1,89  0,07 1,89 1,96 1,83 1,89  0,07 1 1,67 1,64 1,64 1,65  0,02 2 1,42 1,47 1,54 1,48  0,06 6 1,74 1,77 1,81 1,77  0,04 0,65 0,63 0,64 0,64  0,01 24 1,51 1,43 1,53 1,49  0,06 48 0,79 0,81 0,84 0,81  0,02 10 0 1,76 1,92 1,83 1,83  0,08 1,76 1,92 1,83 1,83  0,08 1 1,63 1,60 1,59 1,60  0,02 2 1,36 1,38 1,45 1,40  0,05 6 1,69 1,68 1,63 1,67  0,03 0,56 0,56 0,57 0,56  0,01 24 1,20 1,20 1,22 1,21  0,01 48 0,70 0,68 0,66 0,68  0,02 15 0 1,58 1,65 1,70 1,64  0,06 1,58 1,65 1,70 1,64  0,06 1 1,41 1,37 1,38 1,39  0,02 2 1,13 1,07 1,05 1,09  0,04 6 1,29 1,33 1,22 1,28  0,05 0,36 0,38 0,40 0,38  0,02 24 0,84 0,79 0,73 0,79  0,05 48 0,39 0,43 0,40 0,41  0,02 22 Phụ lục 23. Ảnh hưởng của nồng độ cơ chất đến hoạt tính của LacA-WT và biến thể Dòng đột biến Nồng độ oNPG (mg/ml) Hoạt tính (IU/mg) Hoạt tính trung bình (IU/mg) Lần 1 Lần 2 Lần 3 WT 0,5 0,398 0,402 0,418 0,406  0,011 1 0,627 0,631 0,638 0,632  0,006 2 1,073 1,040 1,064 1,059  0,017 3 1,336 1,273 1,329 1,313  0,034 4 1,696 1,676 1,671 1,681  0,013 5 1,867 1,842 1,833 1,847  0,017 Ala301Glu 0,5 0,160 0,158 0,160 0,159  0,001 1 0,302 0,291 0,276 0,290  0,013 2 0,416 0,396 0,404 0,405  0,010 3 0,489 0,502 0,471 0,487  0,016 4 0,567 0,573 0,598 0,579  0,016 5 0,604 0,624 0,640 0,623  0,018 Ala301Val 0,5 0,158 0,188 0,188 0,178  0,017 1 0,241 0,286 0,277 0,268  0,024 2 0,375 0,404 0,424 0,401  0,024 3 0,459 0,492 0,504 0,485  0,023 4 0,498 0,596 0,567 0,554  0,050 5 0,588 0,624 0,625 0,612  0,021 Ala301Tyr 0,5 0,197 0,173 0,182 0,184  0,012 1 0,308 0,287 0,311 0,302  0,013 2 0,475 0,456 0,467 0,466  0,010 3 0,611 0,511 0,538 0,553  0,052 4 0,739 0,604 0,642 0,662  0,069 5 0,814 0,709 0,713 0,745  0,059 Phe361Tyr 0,5 0,224 0,218 0,227 0,223  0,005 1 0,309 0,307 0,307 0,307  0,001 2 0,440 0,433 0,422 0,432  0,009 23 3 0,553 0,556 0,538 0,549  0,010 4 0,647 0,649 0,642 0,646  0,003 5 0,778 0,776 0,758 0,770  0,011 Leu373Cys 0,5 0,150 0,167 0,160 0,159  0,008 1 0,237 0,244 0,260 0,247  0,012 2 0,410 0,395 0,402 0,402  0,007 3 0,506 0,501 0,511 0,506  0,005 4 0,613 0,627 0,595 0,611  0,016 5 0,637 0,584 0,594 0,605  0,028 Leu373Met 0,5 0,309 0,292 0,306 0,302  0,009 1 0,485 0,498 0,479 0,487  0,010 2 0,755 0,728 0,741 0,741  0,014 3 0,932 0,987 0,941 0,953  0,029 4 1,074 1,066 1,096 1,078  0,015 5 1,174 1,076 1,094 1,114  0,052 Bacillus subtilis strain G1 beta-galactosidase gene, complete cds GenBank: EU585783.1 FASTA Graphics Go to: LOCUS EU585783 2064 bp DNA linear BCT 12 APR-2008 DEFINITION Bacillus subtilis strain G1 beta-galactosidase gene, complete cds. ACCESSION EU585783 VERSION EU585783.1 KEYWORDS . SOURCE Bacillus subtilis ORGANISM Bacillus subtilis Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus. REFERENCE 1 (bases 1 to 2064) AUTHORS Quyen,D.T., Tran,V.G., Nguyen,S.L.T. and Dinh,D.K. TITLE Gene cloning, sequencing, expression and characterization of a galactosidase gene from Bacillus subtilis strain G1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 2064) AUTHORS Quyen,D.T., Tran,V.G., Nguyen,S.L.T. and Dinh,D.K. TITLE Direct Submission JOURNAL Submitted (21-MAR-2008) Enzyme Biotech, Institute of Biotechnology,Vietnamese Academy of Science and Technology, 18 Hoang Quoc Viet Road, Distr. Caugiay, Hanoi 10600, Vietnam FEATURES Location/Qualifiers source 1..2064 /organism="Bacillus subtilis" /mol_type="genomic DNA" /strain="G1" /db_xref="taxon:1423" CDS 1..2064 /codon_start=1 /transl_table=11 /product="beta-galactosidase" /protein_id="ACB72733.1" /translation="MMSKLEKTHVTKAKFMLHGGDYNPDQWLDRPDILADDIKLMKLS HTNTFSVGIFAWSALEPEEGVYQFEWLDDIFERIHSIGGRVILATPSGARPAWLSQTY PEVLRVNASRVKQLHGGRRNHCLTSKVYREKTRHINRLLAERYGNHPGLLMWHISNEY GGDCHCDLCQHAFREWLKSKYDNSLKALNQAWWTPFWSHTFNDWSQIESPSPIGENGL HGLNLDWRRFVTDQTISFYKNEIIPLKELTPDIPITTNFMADTPDLIPYQGLDYSKFA KHVDVISWDAYPVWHNDWESTADLAMKVGFINDLYRSLKQQSFLLMECTPSAVNWHNV NKAKRPGMNLLSSMQMIAHGSDSVLYFQYRKSRGSSEKLHGAVVDHDNSPKNRVFQEV AKVGETLERLSEVVGTKRPAQTAILYDWENHWAFGDAQGFAKATKRYPQTLQQHYRTF WEHDIPVDVITKEQDFSPYKLLIVPMLYLISEDTISRLKAFTADGGTLVMTYISGVVN EHDLTYTGGWHPDLQAIFGVEPLETDTLYPKDRNAVSYRSQIYEMKDYATVIDVKTAP VEAVYQEDFYARTPAVTSHQYQQGKAYFIGARLEDQFHRDFYEGLITDLSLSPVFPVR HGKGVSVQARQDQDNDYIFVMNFTEEKQLVTFDQSVKDIMTGDILSGDLTMEKYEVRI VVNTH" ORIGIN 1 gtgatgtcaa agcttgaaaa aacgcacgta acaaaagcga aatttatgct ccatggggga 61 gactacaacc ccgatcagtg gctggatcgg cccgatattt tagctgacga tatcaaactg 121 atgaagcttt ctcatacgaa tacgttttct gtcggtattt ttgcatggag cgcacttgag 181 ccggaggagg gcgtatatca atttgaatgg ctggatgata tttttgagcg gattcacagt 241 ataggcggcc gggtcatatt agcaacgccg agcggagccc gtccggcctg gctgtcgcaa 301 acctatccgg aagttttgcg cgtcaatgcc tcccgcgtca aacagctgca cggcggaagg 361 cgcaaccact gcctcacatc taaagtctac cgagaaaaga cacggcacat caaccgctta 421 ttagcagaac gatacggaaa tcacccgggg ctgttaatgt ggcacatttc aaacgaatac 481 gggggagatt gccactgtga tctatgccag catgcttttc gggagtggct gaaatcgaaa 541 tatgacaaca gcctcaaggc attgaaccag gcgtggtgga cccctttttg gagccatacg 601 ttcaatgact ggtcacaaat tgaaagccct tcgccgatcg gtgaaaatgg cttgcatggc 661 ctgaatttag attggcgccg gttcgtcacc gatcaaacga tttcgtttta taaaaatgaa 721 atcattccgc tgaaagaatt gacgcctgat atccctatca caacgaattt tatggctgac 781 acaccggatt tgatcccgta tcagggcctc gactacagca aatttgcaaa gcatgtcgat 841 gtcatcagct gggacgctta tcctgtctgg cacaatgact gggaaagcac agctgatttg 901 gcgatgaagg tcggttttat caacgatctg taccgaagct tgaagcagca gtctttctta 961 ttaatggagt gtacgccaag cgcggtcaat tggcataacg tcaacaaggc aaagcgcccg 1021 ggcatgaatc tgctgtcatc catgcaaatg attgcccacg gctcggacag cgtactctat 1081 ttccaatacc gcaaatcacg ggggtcatca gaaaaattac acggagcggt tgtggatcat 1141 gacaatagcc caaagaaccg cgtctttcaa gaagtggcca aggtaggcga gacattggaa 1201 cggctgtccg aagttgtcgg aacgaagagg ccggctcaaa ccgcgatttt atatgactgg 1261 gaaaatcatt gggcgttcgg ggatgctcag gggtttgcga aggcgacaaa acgttatccg 1321 caaacgcttc agcagcatta ccgcacattc tgggaacacg atatccctgt cgacgtcatt 1381 acgaaagaac aagacttttc accatataaa ctgctgatcg tcccgatgct gtatttaatc 1441 agcgaggaca ccatttcccg tttaaaagcg tttacggctg acggcggcac cttagtcatg 1501 acgtatatca gcggggttgt gaatgagcat gacttaacat acacaggcgg atggcatccg 1561 gaccttcaag ctatatttgg agttgagcct cttgaaacgg acaccctgta tccgaaggat 1621 cgaaacgctg tcagctaccg cagccaaata tacgaaatga aggattatgc aaccgtgatt 1681 gatgtaaaga ctgctccagt ggaagcggtg tatcaagagg atttttacgc ccgtacgcca 1741 gctgtcacaa gccatcaata tcagcagggc aaggcgtatt ttatcggcgc gcgtttggag 1801 gatcaatttc accgtgattt ctatgagggt ctgatcacag acctgtctct ttcacctgtt 1861 tttccggttc ggcatggaaa aggcgtctcc gtacaagcga ggcaggatca ggacaatgat 1921 tatatttttg tgatgaactt tacggaagaa aaacagctgg tcacgtttga ccagagtgtg 1981 aaggacataa tgacaggaga catattgtca ggcgacctga cgatggaaaa gtatgaagtg 2041 agaattgtcg taaacacaca ttaa

Các file đính kèm theo tài liệu này:

  • pdfluan_an_nghien_cuu_vai_tro_cua_mot_so_goc_axit_amin_doi_voi.pdf
  • docThong tin luan an _Web_NTThao_K2010.doc
  • docTom tat luan an_NTThao_K2010.doc
Luận văn liên quan