Thao tác kỹ thuật trên saccharomyces cerevisiae ảnh hưởng đến quá trình lên men rượu

Đề tài: THAO TÁC KỸ THUẬT TRÊN SACCHAROMYCES CEREVISIAE ẢNH HƯỞNG ĐẾN QUÁ TRÌNH LÊN MEN RƯỢU (ĐHBKTPHCM + kèm ppt báo cáo) MỤC LỤC CHƯƠNG 1: MỞ ĐẦU 1 1.1.Đặt vấn đề chọn đề tài. 1 1.2.Mục đích nghiên cứu. 1 1.3.Nhiệm vụ của đề tài. 2 1.4.Ý nghĩa thực tiễn. 2 CHƯƠNG 2: TÁC ĐỘNG CỦA CÁC YẾU TỐ TRUYỀN THỐNG 4 KHÁI QUÁT CÔNG NGHỆ SẢN XUẤT RƯỢU VÀ TÁC ĐỘNG CỦA CÁC YẾU TỐ TRUYỀN THỐNG ĐẾN QUÁ TRÌNH LÊN MEN RƯỢU 4 2.1.Khái quát chung về công nghệ sản xuất rượu vang. 4 2.1.1.Lịch sử sản xuất rượu vang 4 2.1.2.Sơ đồ quy trình công nghệ sản suất rượu vang trắng và vang đỏ: 5 2.1.3. Một số công đoạn quan trọng trong quá trình sản xuất rượu vang. 6 2.1.4. Nguyên liệu sản xuất rượu vang. 8 2.2.Tổng quan nấm men. 8 2.2.1. Tăng trưởng ,dinh dưỡng. 9 2.2.2. Sinh thái. 10 2.2.3. Sinh sản: 10 2.2.4. Ứng dụng: 10 2.3. Nấm men Saccharomyces Cerevisiae. 11 2.3.1 Đặc điểm sinh thái, thành phần cấu tạo, sinh trưởng và phát triển ở Saccharomyces cerevisiae. 11 2.3.2. Một số chủng Saccharomyces: 18 2.4.Cơ sở khoa học của quá trình lên men rượu. 20 2.5.Các yếu tố ảnh hưởng đến nấm men Saccharomyces cerevisiae trong quá trình lên men rượu. 24 2.5.1. Ảnh hưởng của nhiệt độ : 24 2.5.2. Ảnh hưởng của pH tới quá trình lên men và tác động của các acid lên sự thay đổi pH. 27 2.5.3. Ảnh hưởng của SO2: 31 2.5.4. Ảnh hưởng nguồn Carbon 33 2.5.5. Ảnh hưởng của nguồn nitơ: 34 2.5.6. Ảnh hưởng của nồng độ đường ( ảnh hưởng của áp suất thẩm thấu). 35 2.5.7 Ảnh hưởng của nồng độ ethanol lên quá trình lên men của Saccharomyces cerevisiae. 36 2.5.8 Ảnh hưởng của một số hóa chất và chất sát trùng. 38 2.5.9. Ảnh hưởng của sục khí. 38 CHƯƠNG 3: TÁC ĐỘNG CỦA THAO TÁC KỸ THUẬT 40 TÁC ĐỘNG CỦA THAO TÁC KỸ THUẬT TRÊN GEN HSP26 VÀ YHR087W LÊN QUÁ TRÌNH LÊN MEN RƯỢU 40 3.1. Tổng quan về HSP26 và YHR087W và giá trị thực tiễn đối với quá trình lên men rượu. 40 3.1.1. Tổng quan và chức năng HSP26,ý nghĩa đối với quá trình lên men rượu. 40 3.1.2. Tổng quan và chức năng YHR087W,ý nghĩa đối với quá trình lên men rượu. 43 3.1.3. Cơ chế biểu hiện của HSP26 và phương pháp nghiên cứu trên HSP26 và YHR087W. 44 3.1.4. Phương pháp nghiên cứu trên gen HSP26 và YHR087W. 45 3.2. Kết quả của thao tác gen tác động lên mức độ biểu hiện của gen HSP26 và YHR087W 47 3.2.1.Minh chứng sự biểu hiện của HSP26 dưới các điều kiện tác động nhiệt. 47 3.2.2 Ảnh hưởng của việc đưa gen HSP26 và YHR087W thành một plasmid multicopy dưới sự kiểm soát của promoter của chúng. 49 3.2.3 Hiệu quả của việc đưa gen HSP26 và YHR087W vào một centromeric plasmid dưới sự kiểm soát của promoter nó. 50 3.2.4 Ảnh hưởng của sự thay thế promoter HSP26 hoặc YHR087W bằng promoter của gen SPI1. 52 3.2.5 Ảnh hưởng của thay thế các promoter YHR087W bởi promoter của gen PGK1 bởi một trong những bản sao di truyền của nó 53 CHƯƠNG 4: BÀN LUẬN VÀ HƯỚNG PHÁT TRIỂN 54 4.1.Bàn luận 54 4.2 Hướng phát triển. 55 4.2.1 Phát triển dựa trên các phương pháp kiểm soát tối ưu điều kiện lên men. 55 4.2.2 Phát triển dựa trên việc cải tiến hệ gen của chủng nấm men Saccharomyces cerevisiae. 56 Tài liệu tham khảo: 57 PHỤ LỤC 60

doc69 trang | Chia sẻ: lvcdongnoi | Ngày: 25/01/2013 | Lượt xem: 4871 | Lượt tải: 22download
Bạn đang xem nội dung tài liệu Thao tác kỹ thuật trên saccharomyces cerevisiae ảnh hưởng đến quá trình lên men rượu, để tải tài liệu về máy bạn click vào nút DOWNLOAD ở trên
dung dịch nào đó, ví dụ cùng một pH nhưng độ chua của dịch đường hóa từ ngô bao giờ cũng lớn hơn từ sắn . Trong thực tế sản xuất không phải cơ sở nào cũng có điều kiện đo pH, mà thường chỉ xác định độ chua. Đối với mỗi dung dịch nào đó thì pH có thể xem như gần ổn định còn độ chua lại thay đổi nhiều phụ thuộc vào mức độ nhiễm khuẩn của nguyên liệu và dịch lên men. Khi nhiễm khuẩn sẽ tạo acid hữu cơ có độ phân ly thấp nên ít làm thay đổi pH. Vì vậy trong sản xuất rượu không chỉ xác định pH mà còn xác định độ chua. Độ chua có thể biểu diễn theo độ hay theo gam acid / lít. Một độ chua được biểu diễn bằng 1ml dung dịch NaOH 2M vừa đủ để trung hòa acid tự do chứa trong 20 ml dịch hoặc biểu diễn độ chua bằng gam H2SO4/lít dịch, 10 chua = 2,45 g /l. 2.5.2.2 Tác động của một số acid lên pH trong suốt quá trình lên men. Tác động của acid tartaric trong quá trình lên men và thay đổi pH.Tartaric ở nồng độ 5-10g/l là nồng độ thích hợp cho quá trình lên men xảy ra ở mức độ cao và rút ngắn thời gian lên men của quá trình. Hình 2.5.3: Những sự thay đổi trong mức độ lên men tối đa (♦), ngày lên men kết thúc(▲), pH cuối của quá trình lên men(●) do ảnh hưởng của acid tartaric[10]. Khi sử dụng nồng độ tartaric ở 0g/l thì thời gian lên men là dài nhất, đến 18 ngày. pH cũng có sự thay đổi trong quá trình, trong quá trình lên men không có sự bổ sung tartaric thì pH giữ khá ổn định trong quá trình lên men pH=2,4 Trong khi đó với sự bổ sung acid tartaric với nồng độ 20g/l pH sau quá trình lên men là 3,5. Sự tác động ở các khác nhau đã ảnh hưởng tới mức độ hoàn thành quá trình lên men.Ở pH 3.5, 4.5 và 5.5 thời gian lên men là tương đương nhau. Riêng ở pH 2.5 thời gian lên men diễn ra lâu hơn và mức độ lên men cũng diễn ra khá chậm. Bảng 2.6: Thông số động lực học và pH kết thúc quá trình lên men với những pH ban đầu khác nhau trong môi trường có sự thiếu hụt hoặc hiện diện của acid tartaric. Hình 2.5.4: Những minh chứng của cho sự thay đổi pH trong quá trình lên men: (A)pH bắt đầu lên men tại các giá trị khác nhau( đường nét đứt và kí hiệu mở) và không sử dụng acid tataric( nét liền và kí hiệu đậm)[ pH ban đầu:2,5 (◊), 3,5(∆), 4,5 (○) và 5,5()]; (B) pH trong quá trình lên men với sự hiện diện (●) và thiếu (▲) acid tataric trong những giờ đầu của quá trình lên men[10]. Bảng 2.7: Ảnh hưởng của một số acid lên sự sự sinh trưởng của nấm men. AcidNồng độThời gian tiêu diệt nấm men ( giờ)Làm ngừng sinh trưởngTiêu diệt men%mol/l%mol/lHCl0,140,0380,720,1950,46H2SO40,390,0391,300,1232,04H3PO40,300,0312,000,2041,28CH3COOH0,750,1253,000,5001,25Acid lactic0,900,1003,000,3331,27 Hình 2.5.5: Một số acid có mặt trong nội bào trong suốt quá trình lên men của hèm nho ở 25oC: (gạch sọc) nấm men khô; (màu đen) giữa quá trình lên men; ( trắng) kết thúc quá trình lên men[10]. Hình 2.5.6: Sự thay đổi pH tại các nồng độ acid hữu cơ khác nhau, (A) tại nồng độ 0g/l acid, (B) tại nồng độ 5g/l acid: (♦)nồng độ kiểm soát; (■) acid tartaric;(▲) acid malic; (×) acid citric; (●) acid succinic[10]. Việc sủ dụng những acid hữu cơ ở những nồng độ khác nhau đã cho thấy sự khác biệt rõ rệt trước và sau khi sử dụng các acid hữu cơ vào quá trình lên men. Bên cạnh đó, hoàn toàn nhận thấy sự biểu hiện của các acid trong những thay đổi này ở các mức độ khác nhau( hình B) làm ảnh hưởng tới quá trình lên men. 2.5.3. Ảnh hưởng của SO2: So với các loại vi sinh vật khác nấm men rất bền với các điều kiện tác động của SO2. Việc sử dụng SO2 trong sản xuất rượu vang được dùng để ức chế và tiêu diệt một phần các vi sinh vật có hại đến quá trình lên men.Sự có mặt của SO2 sẽ kéo dài quá trình lên men.[39]. SO2 được xem như là chất chống oxy hóa quan trọng trong lĩnh vực sản xuất rượu. Các nghiên cứu gần đây cho thấy nồng độ giới hạn của SO2 trong rượu được giới hạn ở mức tối đa là 200ppm. Được những tổ chức quốc tế khuyến cáo là tốt cho sức khỏe của người dùng. SO2 tác động đến quá trình lên men đặc biệt là trong quá trình lên men malolactic và tác động lên sự giảm hàm hàm lượng acid malic có trong rượu vang. SO2 được biết đến như một tác nhân chống lại các vi sinh vật gây hại trong rượu . nguồn SO2 được lấy từ 3 nguồn chính: trong các hợp chất của trái cây( glucose và arabinose), trong quá trình trao đỏi chất tạo sản phẩm của vi sinh vật (Gluconobacter và Acetobacter), và trong quá trình lên men có thể tạo ra aetaldehyde, pyruvic và acid 2-oxoglutamic. SO2 hạn chế nguồn dinh dưỡng đối với ví sinh vật ,ức chế sự cạnh tranh quá trình oxy hóa polyphenol, trong môi trường hèm nho nó cạnh tranh trực tiếp với sự làm giảm hàm lượng oxy , làm oxy trở nên có tính cấp thiết đối với Saccharomyces [9]. Hình 2.5.7: Ảnh hưởng của SO2 lên ethanol và acetaldehyde .(♦) môi trường có bổ sung SO2, (◊) môi trường không bổ sung SO2[9]. Việc sử dụng SO2 trong quá trình sản xuất rượu vang là điều kiện cần thiết cho sự ổn định về chất lượng vang và giảm lượng vi sinh có hại đến mức tối thiểu, cũng như là phòng tránh, ngăn chặn sự hình thành các loại độc tố từ các chủng nấm men thuần gây ra. SO2 ảnh hưởng trên sự hình thành acetandehyde. Việc hình thành Acetandehyde nói chung phụ thuộc trên loài hoặc chủng nấm men sử dụng nhưng các nhân tố như là nhiệt độ,oxy , và SO2 tác động lên quá trình hình thành acetandeyde một cách tốt nhất. Tác động lên sự lên men malolactic: Sự ức chế của những chủng thuần lên quá trình lên men và các chủng lên men axit lactic.Trong trường họp này sự thêm vào SO2 không còn có sự tác dụng tương tự, nhưng cũng đã có sự thay đổi chiều hướng phần nào. Nồng độ của acetandehyde phần nào tác động đến sự lên men malolactic,khi nồng độ vượt quá 100mg/l thì trở thành nhân tố ảnh hưởng đến quá trình lên men lactic,trong khi ở mức độ thấp hơn ( disaccharides > Pentoses > polysaccharides Carbonhydrate có cấu trúc hóa học gần giống với polyhydroxyaldehyde cũng như là polyhydroxyketone. Thông thường chúng có thể được chia thành 3 nhóm : các monosaccharide, các disaccharide và các polysaccharide. Carbonhydrate có một quy luật trọng tâm trong quá sinh tổng hợp năng lượng, sản xuất ra ATP. Tiến trình bẽ gãy các polysaccharide và các disaccharide thành các loại đường đơn giản hơn là nguồn nguyên liệu chính của hợp chất giàu năng lượng. Trong suốt quá trình trao đổi chất, glucose, sẽ chuyển hóa thành CO2, nước và năng lượng.Ba con đường chuyển hóa có quan hệ mật thiết kiểm soát quá trình trao đổi carbonhydrate[7]. Glucose qua quá trình biến đổi kỵ khí sẽ chuyển thành pyruvic và từ đó hình thành ethanol hoặc acid lactic. Từ pyruvic acid nó có vào quá trình oxy hóa theo con đường TCA(TriCarboxylic Acid cycle). Cứ mỗi phân tử glucose sẽ tạo thành 2 phân tử ATP được diễn ra trong EMP. Trong quá trình lên men sự hình thành acid pyruvic có thể tạo ra nhiều loại sản phẩm khác nhau, như ethanol, acid lactic, acid butyric, acetone và isopropanol. Chu trình TCA: chức năng của chu trình TCA là chuyển hóa pyruvic và acid lactic,tạo thành những sản phẩm cuối cùng CO2 và H2O. Nó cũng là kênh chuyển hóa cuối cùng sự oxy hóa các acid béo và bộ khung Carbon của nhiều acid amin.Phản ứng : EMP và chu trình TCA là những chu trình cung cấp nguồn năng lượng ATP chính, trong khi chúng cũng cung cấp năng lượng cho quá trình tổng hợp các acid amin và lipit. Chu trình pentose phosphate điều khiển hàm lượng pentose quan trọng cho nucleotide (ribose-5-phosphate) và sinh tổng hợp acid béo (NADPH2). Nấm men Saccharomyces cerevisiae sử dụng nguồn glucose, fructose và sucrose mà không có bất cứ khó khăn nào. Đôi khi nấm men còn sử dụng được galactose và maltose nhưng hiếm khi xảy tra.Quá trình trao đổi chất của Saccharomyces cerevisiae tuân theo EMP và tạo ra sản phẩm là ethanol, 2 phân tử ATP từ một phân tủ đường glucose. 2.5.5. Ảnh hưởng của nguồn nitơ: Nguồn Nito bổ sung trong quá trình lên men được đánh giá là nhân tố quan trọng ảnh hưởng trực tiếp đến chất lượng và hiệu suất của quá trình lên men. Trong nhiều tình huống nghiên cứu khác nhau, nito được khảo sát theo 3 hướng: Cung cấp lượng nito vừa đủ cho quá trình lên men, giới hạn lượng nito của quá trình lên men và thiếu hụt lượng nito theo bảng 2.7 [20]. Trong công nghiệp lên men rượu sử dụng amoniac là nguồn nito chính. Nhưng các amino acid cũng được xem là nguồn cung cấp nguồn nito vô cùng giá trị trong công nghiêp sản xuất rượu vang. Amoniac và các amino acid được đề cập đến như là những nguồn Nito chính đối với nấm men. Khi acid tataric không hiện diện trong môi trừơng, sự thay đổi trong nồng độ của amoni đã không đủ để tránh khỏi những tác động làm chậm quá trình lên men[10]. Ngoài ra việc bổ sung nguồn nito còn được cung cấp từ nhiều nguồn khác nhau: các muốn amoni sunphate, Urea…Bổ sung nitơ với số lượng 30 mg/100ml sẽ rút ngắn thời gian từ 84 giờ xuống 60 giờ, đồng thời lên men cũng tốt và đạt hiệu quả cao hơn mẫu đối chứng. Trong đó nguồn nitơ từ ure cho kết quả tốt hơn. Bảng 2.8: Các thông số đánh giá trong quá trình lên men với thành phần môi trường lên men chứa 20% glucose và các nguồn Nito ban đầu khác nhau[20]. CF: Kiểm soát quá trình lên men(267mg N/l); LN : lượng Nito thấp trong quá trình lên men(66mg N/l); RF: ưu tiên cho quá trình lên men(66 + 200mg N/l cung cấp trong vòng 72 giờ và muối Diamoni sunfate). 2.5.6. Ảnh hưởng của nồng độ đường ( ảnh hưởng của áp suất thẩm thấu). Dưới điều kiện nồng độ glucose cao S. cerevisiae vẫn biểu hiện khả năng lên men[12].Nồng độ dịch đường cao làm tăng áp suất, mất cân bằng trạng thái sinh lý của nấm men. Kết quả là cồn nhiều sẽ ức chế không những tạp khuẩn mà cả nấm men, dẫn đến tổn thất hoặc phải kéo dài thời gian lên men.Nồng độ dịch đường thấp làm giảm năng suất thiết bị lên men. Những tác động của nồng độ glucose cao ảnh hưởng trực tiếp lên sự trao đổi chất và sự biểu hiện của toàn bộ hệ gen. Áp suất thẩm thấu lớn (300mg/l glucose) đã tác động lên sự thay đổi lên hệ gen của nấm men. Kết quả đã tạo ra nguồn năng lượng lớn trong tế bào, sự hình thành các sản phẩm bậc 1 và bậc 2. Ở các nồng độ dịch đường khác nhau tương ứng với thời gian tiến vào pha log cũng khác nhau. Điều này cho thấy rằng nồng độ glucose có tác động trực tiếp đến sự sinh trưởng và phát triển của nấm men từ khi bắt đầu quá trình lên men cho đến khi kết thúc quá trình[12]. Bảng 2.9: Tác động của glucose lên một số yếu tố trong quá trình lên men[12]. Nồng độ glucoseThời gian tiến vào pha log(giờ)Thời gian hoàn thành pha log(giờ)Ethanol tạo sau khi hoàn thành pha log(g/l)pH của môi trườngGlycogen thu được sau 68h lên men(g/l)120g/l46854,33,13,8210g/l68872,42,85,2300g/l89689,32,38,6 Thông thường khống chế nồng độ chất khô của dịch đường từ 16 – 18 % ( tùy theo mức độ thuần khiết), tương đương 13 – 15% đường, để sau khi lên men sẽ nhận được nồng độ rượu trong giấm chín là 8,5 – 9,5 % V. Hình2.5.9 thể hiện sự giảm nồng độ glucose trong quá trình lên men đồng thòi cho thấy sư tác động của glucose lên sự phát triển của nấm men. 2.5.7 Ảnh hưởng của nồng độ ethanol lên quá trình lên men của Saccharomyces cerevisiae. Những tác động của ethanol đã ảnh hưởng tới 6138 gen,và trên các gen này ethanol có những tác động thuận lợi cũng như có như có những tác động không thuận lợi cho sự biểu hiện của gen. Những biểu hiện của các gen này đã cho thấy một bức tranh toàn cảnh trong cơ chế các phản ứng trong quá trình sản xuất rượu dưới điều kiện tác động của ethanol ở nồng độ cao[18]. Điều đáng quan tâm trong cơ chế ảnh hưởng của ethanol cho thấy hầu hết tất cả các gen đều có liên quan đến cơ chế tổng hợp trahalose được biểu hiện mạnh. Tương tự đó các biểu hiện của các gen sHSPs cũng cho thấy sự thay đổi trong biểu hiện, hầu hết các gen đều bị cảm ứng trước tác động của ethanol, ngoài ra một minh chứng cụ thể cũng đã cho thấy những sự tác động lên cơ chế chống oxy-hóa. Trong quá trình lên men ở nồng độ ethanol 7% đã cho thấy: có 3,2% gen có biểu hiện ở mức độ giảm.63,6% gen có biểu hiện tăng so với trước trong đó có 49,4% phụ thuộc vào điều kiện stress của môi trường. 14,2% phụ thuộc vào chủng nấm men kháng stress[18]. Hình 2.5.9: Sự giảm glucose, ethanol, và nồng độ glycerol cũng như là sự phát triển của nấm men dưới những điều kiện khác nhau về nồng độ glucose: 120g/l(∆), 210g/l(), và 300g/l (○). Kí hiệu các ô được tô đen biểu diễn cho (A) OD650, hoặc (B) glycerol; kí hiệu không tô đen biểu diễn cho (A) glucose, hoặc (B) ethanol. Thí nghiệm được thực hiện 3 lần[12]. Sự cảm ứng dưới các điều kiện khác nhau liên quan đến nhiều yếu tố như khả năng bảo vệ tế bào dưới tác động nhiệt ,sự sinh tổng hợp trahalose,cơ chế chống oxyhoa cũng như là khả năng đáp ứng stress[18]. Khả năng ức chế hoạt động của ethanol bắt đầu tại nồng độ 5% và phụ thuộc vào điều kiện nuôi cấy và chủng nấm men sử dụng. Khi tăng nồng độ của ethanol thì tác động hưởng và phụ thuộc hoàn toàn vào khả năng lên men và khả năng của chủng nấm men. Cơ chế dưới tác động của ảnh hưởng của ethanol là rất phức tạp[22,2]. 2.5.8 Ảnh hưởng của một số hóa chất và chất sát trùng. Trong điều kiện sản xuất, dù có vệ sinh sạch đến mấy cũng khó đảm bảo vô trùng tuyệt đối, vì vậy cần phải dùng chất sát trùng để ngăn ngừa và hạn chế tạp khuẩn. Có thể dùng hóa chất khác nhau như clorua vôi, formalin, fluosilicat natri. Tùy theo chất lượng của hóa chất mà dùng nhiều hay ít, cốt sao hạn chế được phát triển của tạp khuẩn nhưng không làm ảnh hưởng xấu đến hoạt động của nấm men.Khi dùng formalin hay fluosilicat natri, nồng độ không vượt quá 0,02% so với dịch lên men. Tùy theo tính chất và mức độ phân ly của mỗi acid mà tác hại của chúng lên nấm men sẽ không giống nhau.Ngoài ra, trong dịch đường lên men luôn chứa một lượng furfurol, melanoidin, cũng gây ảnh hưởng tới nấm men. Furfurol hạn chế khả năng nảy chồi và kích thước tế bào, tạo ra các hạt trong không bào. Furfurol chứa nhiều trong mật rỉ có thể làm giảm khả năng tạo rượu và tăng các tạp chất, giảm hoạt độ của maltase và zymase của nấm men. Khi dịch chứa 4 – 6 triệu tế bào/ml thì 0,002% furfurol sẽ ảnh hưởng xấu đến sinh trưởng và sinh lý của dịch lên men; khi dịch lên men chứa 90 triệu / ml thì 0,006% furfurol mới ảnh hưởng tới sinh lý nấm men. Hàm lượng furfurol trong mật rỉ thường vào khoảng 6 đến 8 g / 100 g chất khô. Nếu mật rỉ pha loãng tới 20 – 22% thì nồng độ sẽ khoảng 1,5 – 2,0 mg / 100ml (0,0015 – 0,002%). Trong điều kiện lên men với tỉ lệ men giống lớm hơn 10%, ảnh hưởng của furfurol xem như không đáng kể. Melanoidin có ảnh hưởng không giống nhau đối với các chủng men. Nó ảnh hưởng xấu đến sinh sản của chủng B và IA, chỉ trong 12 giờ đầu đối với chủng r-176 và r-202, melanoidin ảnh hưởng suốt trong thời gian 24 giờ, số tế bào ít hơn 1,3 – 2 lần so với môi trường chứa 0,005 – 0,3g/100 ml. Caramela không bị hấp thụ trên bề mặt nấm men nhưng với nồng độ 0,005% sẽ làm nhiều tế bào bị chết đi. 2.5.9. Ảnh hưởng của sục khí. Sục khí để hòa tan oxy vào dịch đường, giúp cho nấm men phát triển nhanh hơn. Tuy nhiên, sục khí không cần thiết đối với dịch đường từ nguyên liệu tinh bột. Sục khí sẽ làm tăng lượng đường bay hơi. Mặt khác nếu dư dẫn đến tạo nhiều sinh khối và aldehyde, do đó làm giảm hiệu suất lên men rượu. Thực tế thì không cần sục khí vào dịch đường. Một lượng nhỏ oxy sẽ được hòa tan trong thời gian khuấy và làm lạnh, đủ đảm bảo cho sinh trưởng phát triển và lên men. Với tỉ lệ men giống 10%, sau 50 giờ lên men nồng độ biểu kiến của dịch đã giảm tới số lượng không đổi với hầu hết thùng lên men. Sau 70 – 72 giờ nồng độ rượu trong giấm chín đạt trung bình 9% V, đường sót chỉ vào khoảng 0,3 – 0,5 %. Qua những ảnh hưởng của các yếu tố truyền thống đến quá trình lên men rượu đã cho thấy tầm quan trọng của việc kiểm soát các yếu tố liên quan. Ngoài quá trình kiểm soát trên, công nghệ sản xuất rượu ngày nay hướng đến những thay đổi trên hệ gen để tạo ra những chủng nấm men đáp ứng được yêu cầu, cải thiện chất lượng, hạ giá thành sản phẩm. Đó là việc ứng dụng công nghệ sinh học phân tử để cải tiến hệ gen nâm men sẽ được trình bày trong chương tiếp theo. Chương 3: Tác động của thao tác kỹ thuật gen CHƯƠNG 3: TÁC ĐỘNG CỦA THAO TÁC KỸ THUẬT TÁC ĐỘNG CỦA THAO TÁC KỸ THUẬT TRÊN GEN HSP26 VÀ YHR087W LÊN QUÁ TRÌNH LÊN MEN RƯỢU 3.1. Tổng quan về HSP26 và YHR087W và giá trị thực tiễn đối với quá trình lên men rượu. 3.1.1. Tổng quan và chức năng HSP26,ý nghĩa đối với quá trình lên men rượu. sHSPs( small Heat Shock proteins) là những phân tử chapperone có khối lượng phân tử vào khoảng 12-43 kDa đa số có kích thước từ 14-27kDa được tìm thấy hầu hết trongcấu trúc của vi sinh vật, với số lượng của các loại khác nhau tùy từng chủng ( Narberhaus, 2002). Mặc dù chúng có kích thước nhỏ nhưng các thực thể đang hoạt động trong sHSPs thường là các oligomer bao gồm nhiều tiểu đơn vị, gồm trình tự chuỗi đầu N có thể thay đổi độ dài, một đoạn trình tự không thay đổi độ dài gồm khoảng 80 acid amin chứa α-acrytallin và đầu C ngắn ( Caspers et al., 1995). sHSPs có khả năng ngăn chăn sự kết lắng protein và sự hình thành hiện tượng đục thủy tinh thể ở động vật có xương sống. Thông thường các tế bào phức tạp được hình thành từ các mono oligomer, dimer hoặc tetramer. Các cấu trúc phức tạp của sHSPs chịu nhiệt có liên quan đến môi trường của tế bào và các protein được tiết ra từ thành tế bào trong suốt quá trình trong thiết bị phản ứng được gia nhiệt ở trong khoảng thời gian dài Cấu tạo của Hsp26: Hsp26 hình thành chuỗi protein có tổng số 214 acid amin [29]. Được qui định bởi 645 nucleotide. Hps26 nằm trên nhiễm sắc thể II hình thành từ 24 tiểu đơn vị có tác động qua lại có cấu trúc nhị trùng hợp theo khối bền vững ( bảng 3.1). Cấu trúc của hsp26 : Hsp26 được hình thành từ tế bào chất trong tế bào S. cerevisiae. Hsp26 có cấu trúc bao gồm 2 yếu tố chính(Hình 3.1.1): phần đầu N có cấu trúc khối đồng nhất về kích thước và đoạn và đầu C-α-crystallin, bao gồm một đoạn ngắn bên ngoài. Hps26 mang đầu N sẽ bắt đầu tại acid amin 95. N và C ưu tiên nằm ở vị trí cuối của hsp26 ở các đầu tương ứng[23]. Bảng 3.1: Vị trí , thành phần nucleotide và acid amin cấu tạo của HSP26 [29]. Tên gọiYBR072W trên chủng HYPERLINK ""S.cerevisiae                           Tên genHSP26Định danhHsp26pVị tríNhiễm sắc thể số II:382027..382671 Chuỗi Acid Amin214 acid amin  MSFNSPFFDFFDNINNEVDAFNRLLGEGGLRGYAPRRQLANTPAKDSTGKEVARPNNYAGALYDPRDETLDDWFDNDLSLFPSGFGFPRSVAVPVDILDHDNNYELKVVVPGVKSKKDIDIEYHQNKNQILVSGEIPSTLNEESKDKVKVKESSSGKFKRVITLPDYPGVDADNIKADYANGVLTLTVPKLKPQKDGKNHVKKIEVSSQESWGNĐoạn Nucleotide645 nucleotide  atgtcatttaacagtccattttttgatttctttgacaacatcaacaacgaagttgatgcctttaacagattgctgggtgaaggcggcttaagaggctacgcaccaagacgtcagttagcaaacacacccgcaaaggattctactggcaaggaagttgctagaccaaataactatgctggcgctctttatgatcccagagatgaaaccttagatgattggttcgacaatgacttgtccctgttcccatctggtttcggtttccctagaagtgtcgcagttccagttgatattttggaccatgacaacaactacgagttgaaagtcgtggttcctggtgtcaaaagcaagaaggacattgatattgagtaccatcaaaacaagaaccaaattttggtttctggtgaaattccatctaccttgaatgaagagagtaaagacaaggtcaaggtcaaggagagcagctctggtaagttcaagagagtcatcactttgccagactacccaggtgtggatgcagacaacattaaagcagactacgcaaatggtgttttgacattaacagttccaaaattgaagcctcagaaggatggtaagaaccacgtcaagaagattgaggtttcttctcaagaatcgtggggtaactaa Hình 3.1.1: Cấu trúc của HSP26 [23]. Hình 3.1.2: Vị trí của HSP26 trên Nhiễm sắc thể II [31]. Hình 3.1.3: Mô hình cấu trúc không gian của gen HSP26 [24]. Ý nghĩa thực tế của nhóm gen sHSPs, HSP26 và đối với quá trình lên men rượu: Khi tế bào gặp môi trường stress hoặc bất cứ điều kiện nào có thể gây kích thích mạnh mẽ đến tế bào, thì một quá trình tổng hợp protein mới xảy ra như là một đoạn lớn của các protein gấp nếp sẽ bị đột biến một phần hoặc hoàn toàn. Những protein bị biến tính sau đó được nhập qua hệ thống kiểm tra chất lượng để xác định khả năng biểu hiện chaperone. 2 yếu tố được xem xét là DnaK-DnaJ-DnaE và GroEL-GroES được cho là quan trọng hơn so với các sHSPs ( small Heat shock proteins) gấp nếp protein. Tuy nhiên khi xét đến chaperone có sự thay đổi với những cơ chất làm tăng tính kích thích , thì sHSPs có thể sẽ phục hồi những hư hỏng của proterin và bảo vệ protein khỏi những mối nguy hiểm.Điều này được thông qua những protein có tính chất tái gấp nếp, qua những cơ chế biểu hiện chaperone khi mà các gen không chịu tác động lâu dài dưới điều kiện stress. Do đó chúng có khả năng bảo vệ những protein thành tế bào và cân bằng khả năng sống của thành tế bào dưới các điều kiện stress như là shock nhiệt và hóa chất[27]. Chức năng của HSPs :những chức năng cụ thể của sHSPs vẫn chưa được đưa ra cụ thể.Một trong những chức năng cụ thể nhất là khả năng chống lại các ức chế về điều kiện nhiệt độ tác động.Mặc dù trong S. cerevisiae mà hsp26 là sHSP ,hsp 26 không có sự đột biến nào mà có thể tạo nên sự phân biệt rõ ràng trong kiểu hình so với các chủng thuần khác. Hsp26 có khả năng điều chỉnh thích hợp với các điều kiện cảm ứng ,có cấu trúc nhỏ và bị tác động bởi yếu tố nhiệt độ, có thể hình thành những phân tử có kích thước lớn[41,43]. Hsp26 của Saccharomyces cerevisiae là một trong những họ của những protein shock nhiệt có kích thước nhỏ.Tất cả những đáp ứng với nhiệt độ và các điều kiện stress khác bởi sự hình thành những protein được gọi là protein shock nhiệt, những protein này được chia thành các nhóm và có một chức năng rõ ràng.Những protein này có kích thước từ 15-40 kDa.Những protein này có những khả năng đặc biêt : có khả năng chịu được các điều kiện kích thích cao, không chỉ có khả năng đáp ứng các điệu kiện stress mà còn trong suốt quá trình phát triển.Sự tác động của các yếu tố cảm ứng lên hsp 26 không tuân theo quy luật thông thường tác động lên các protein shock nhiệt khác. Hsp26 không có sự biểu hiện khi không có các điều kiên stress xảy ra : nhiệt độ, quá trình tạo bào tử. 3.1.2. Tổng quan và chức năng YHR087W,ý nghĩa đối với quá trình lên men rượu. YHR087W( hay được gọi là RTC3) được biết đến là gen chưa có chức năng rõ ràng, hình thành protein có tổng số 111 acid amin và được cấu tạo từ 336 nucleotide[30]. Bảng 3.2: Vị trí, thành phần nucleotide, acid amin cấu tạo YHR087W [33]. Tên gọiYHR087W trên chủng HYPERLINK ""S.cerevisiae                           Tên genRTC3Định nghĩaProtein không rõ chức năng liên quan đến quá trình trao đổi của RNA, có cấu trúc tương tự như SBDSVị tríNhiễm sắc thể VIII:280822..281157 Chuỗi Acid Amin111aa  MSTVTKYFYKGENTDLIVFAASEELVDEYLKNPSIGKLSEVVELFEVFTPQDGRGAEGELGAASKAQVENEFGKGKKIEEVIDLILRNGKPNSTTSSLKTKGGNAGTKANĐoạn Nucleotide336 nt    atgtctactgtaaccaaatacttttacaagggtgaaaatacagatttgattgtcttcgctgcatccgaagagcttgtagacgaatatttgaaaaatccatcaattggtaagctatctgaagttgtcgaactcttcgaagttttcactcctcaggacggtaggggtgccgagggtgagttgggcgctgcctccaaggcccaagtggaaaatgagttcggtaagggcaagaagatcgaagaagttatcgatttgatattgagaaatggtaagccaaactctaccacctctagtctcaaaaccaaagggggtaacgccggaaccaaagcctacaattga Hình3.1.4: Vị trí, kích thước của YHR087W trên Nhiễm sắc thể VIII của nấm men S.cerevisiae[30,31]. YHR087W là gen không rõ chức năng, liên quan đến quá chình chuyển hóa RNA, có cấu trúc tương tự với SBDS và không có khả năng ngăn chặn những đột biến xảy ra trên cdc13-1 đột biến xảy ra do sự nhạy cảm về nhiệt độ.Chịu tác động bởi một vài yếu kích thích ở nồng độ đường cao, ảnh hưởng đến quá trình phiên mã của nó, quá trình phiên mã được nhận định là tăng lên dưới các điều kiện gây stress: như shock nhiệt, stress thẩm thấu, stress dưới điều kiện nồng độ sorbitol ở mức cao ở pha cân bằng của chu kỳ phát triển của tế bào[19]. Hình 3.1.5: Cấu trúc không gian của YHR087W [30]. 3.1.3. Cơ chế biểu hiện của HSP26 và phương pháp nghiên cứu trên HSP26 và YHR087W. Cơ chế hoạt động của HSP26: Hsp26 được cho là che đậy bởi một protein khác trong quá trình xảy ra những biến đổi đối với hsp26. Thuộc tính của hsp26 có được là khả năng gấp nếp của protein, giúp protein có một cấu trúc phức tạo có khả năng ngăn chặn các điều kiện ngoại cảnh tác động, đặc biệt là nhiệt độ( Hình 3.1.4). Điều này hoàn toàn có thể chấp nhận khi mà không có sự biểu hiện của sự chống lại ức chế nhiệt độ khi không có mặt của hsp26[16]. Hình 3.1.6: Mẫu thể hiện cơ chế của chaperone dưới sự kiểm soát nhiệt độ của sHSP. Hsp26 được cấu thành từ 12 dimer trong phức hợp gồm 24 tiểu đơn vị. Ở trạng thái ái lực thấp thì Hsp26 không có sự tương tác với các protein không gấp nếp. tăng nhiệt độ đến khi có sự thay đổi nhỏ trong cấu trúc của oligomer, với sự chuyển đổi ái lực từ thấp lên cao. Oligemer Hsp26 được kích hoạt và cấu thành hợp chất không gồm các protein nguyên bản trong một cơ chất phức tạp[25]. 3.1.4. Phương pháp nghiên cứu trên gen HSP26 và YHR087W. Gen HSP26 và YHR087W trong nấm men rượu có tính kháng với một số dạng stress và khả năng lên men. Sự tăng cấp độ biểu hiện của gen thông qua 2 phương pháp được ứng dụng trong kỹ thuật di truyền: Tăng số lượng bản sao của gen biểu hiện: bằng cách nhân số lượng lớn bản sao của gen HSP26 và YHR087W cùng với các centromeric plasmid của chúng. Thay thế promoter điều khiển sự biểu hiện của gen bằng cách sử dụng một promoter mạnh hơn promoter của chủng bản đầu: Thay thế promoter 2 gen HSP26 và YHR087W bằng SPI1 và PGK1. PGK1 mã hóa quá trình tạo enzyme glycolytic phophoglycerate 3-kinase. Trong khi SPI1 có biểu hiện điều hòa stress trong suốt quá trình lên men, các gen PGK1 biểu hiện mức độ tối đa của mRNA ở giai đoạn pha log, và giảm dần trong pha cân bằng, phù hợp với tỷ lệ lên men (Puig và Pérez-Ortín , 2000; Rossignol et al 2003.,) [19]. Phương pháp tăng số lượng bản sao của gen biểu hiện: bằng cách nhân số lượng lớn bản sao của gen HSP26 và YHR087W cùng với các centromeric plasmid của chúng. Hình 3.1.6 trình bày phương pháp nhân số lượng bản sao. Thực tế số lượng bản sao của HSP26 hoặc YHR087W có thể nhiều hơn 2 bản sao trên DNA. Hình 3.1.7: Cơ chế nhân số lượng bản sao của gen HSP26 [22]. Phương pháp thay thế promoter điều khiển sự biểu hiện của gen bằng cách sử dụng một promoter mạnh hơn promoter của chủng bản đầu: Thay thế promoter 2 gen HSP26 và YHR087W bằng SPI1 và PGK1( Hình 3.1.8). Hình 3.1.8: Sơ đồ sự hình thành các chủng ICV16 (ICV27)-PPGK1-YHR087W. YHR087f và YHR087g là oligonucleotides được sử dụng để khuếch đại đoạn gen sau khi gắn promoter PGK1 vào vị trí SalI của plasmid pUG6. Các đầu 3’ của một nửa các oligonucleotide bắt cặp với trình tự của pUG6 nằm ở vị trí nucleotide thứ 10 ở đầu 5’ hay đầu 3’(tùy theo các oligonucleotide) của vị trí nối loxP[22]. 3.2. Kết quả của thao tác gen tác động lên mức độ biểu hiện của gen HSP26 và YHR087W 3.2.1.Minh chứng sự biểu hiện của HSP26 dưới các điều kiện tác động nhiệt. Những qui luật biểu hiện của protein dẫn đến phương thức để chọn lọc một protein thiết lập rõ ràng điều kiện tăng trưởng và pha tăng trưởng để thu nhận tối đa lượng sinh khối.Trong những thí nghiệm trên chủng W303-1A, mang plasmid pL19, phát triển trong môi trường YNB tại 28oC và xác định OD ở 570nm, sau đó được tăng lên 39oC trong 90 phút. Hình.3.2.1: Hsp26 biểu hiện trong các chủng khác nhau trước và sau khi sốc nhiệt. (A) nhuộm Coomassie blue- SDS-PAGE của protein tổng số biểu hiện từ các chủng nấm men trong quá trình tăng trưởng và sau khi nhiệt sốc. cột, L13 (hsp26) chủng phát triển ở 28°C; cột 2, L13 gia nhiệt đến 39°C trong 90 phút; ngõ 3, Oli H1 (HSP26) chủng phát triển ở 28°C; cột 4, Oli H1 gia nhiệt đến 39°C trong 90 phút; cột 5, W303-1A có chứa một chủng bản sao nhiễm sắc thể của gen HSP26 và mang theo một plasmid bản sao pL19 với đoạn mã hóa HSP26 phát triển ở 28°C; cột 6, W303-1A gia nhiệt lên 39°C trong 90 phút; P, đại diện cho trọng lượng marker phân tử: galactosidase (116 kDa), phosphorylase B (97,4 kDa), albumin từ huyết thanh trâu bò (66 kDa); ovoalbumin (45 kDa) và carbonic anhydrase(29 kDa). (B) phân tích Western-Blot sử dụng một kháng thể bắt nguồn từ tế bào khác chuyên biệt chống lại tác động của Hsp26 [17]. Dưới các điều kiện kiểm soát, chủng L13, mang đoạn thiếu hụt trên bản sao nhiễm sắc thể của HSP26 và OliH1, chứa một nhiễm sắc thể của HSP26, và được biểu hiện trên môi trường YNB. Một so sánh trên SDS-PAGE đã cung cấp toàn bộ protein của thành tế bào bao gồm các tế bào trước và sau khi tác động nhiệt( Hình 3.2.1A). Chủng W303-1A mang nhiều bản sao của plasmid đã thể hiện một protein lớn của khối lượng phân tử 26kDa không phụ thuộc vào pha phát triển ( Hình 3.2.1A cột 5 ,6). Dải polypeptide không được biểu hiện trên L13( hinh 1A,cột 1 và 2) cũng như là chủng Oli H1 ( hinh 3.2.1A, cột 3 và 4). Điều này chứng tỏ rằng mức độ biểu hiện của hsp26 dựa trên sự tác động của nhiệt độ. Để xác định mức độ biểu hiện của protein đoạn polypeptide, sau khi điện di protein được chuyển sang màng lọc nitrocellulose và biểu hiện bởi một kháng thể HSP26 chuyên biệt. Ngoài ra phân tích Western Blot cũng chỉ ra rằng HSP26 không được biểu hiện trên chủng L13 trước và sau khi shock nhiệt. Cũng như là các tế bào của Oli H1(Hình. 3.2.1B, cột 3),nhưng nó bị tác động tác động nhiệt (hình. 3.2.1B, cột 4),và nó được biểu hiện bởi các tế bào chứa các bản sao của plasmid (Hình. 3.2.1B, cột 5và 6). Những kết quả rõ ràng sự biểu hiện của protein như HSP26 và chỉ ra rằng sự gắn Hsp26 trong những bản sao của plasmid hướng đến sự điều chỉnh phiên mã của gen này [17]. 3.2.2 Ảnh hưởng của việc đưa gen HSP26 và YHR087W thành một plasmid multicopy dưới sự kiểm soát của promoter của chúng. Hình 3.2.2: Ảnh hưởng của việc gắn gen HSP26 và YHR087W vào plasmid YEp352 trên gen biểu hiện và kháng stress.* chỉ ra rằng sự khác biệt giữa biến đổi gen và các chủng thuần được thống kê ý nghĩa theo phân tích ANOVA (P ≤ 0,05)[22]. Chủng nấm men ICV16 ura3-và ICV27 ura3- đã được thay plasmid YEp352, YEpHSP26 và YEpYHR087W. Xác định mức độ tác động trên cấp độ mRNA của những gen này, RNA được phân lập sau 2h phản ứng trong ethanol 10% hoặc glucose 25%. Các RNA được phân tích bởi Northern blot trong trường hợp của HSP26. Vì mức độ biểu hiện của YHR087W thấp nên sử dụng Real Time PCR để phát hiện và định lượng. Bảng A của hình. 2 trình bày các kết quả thu được trong các phân tích này. Ở nồng độ glucose 25% một sự biểu hiện quan trọng của gen HSP26 đã được tìm thấy trong cả hai chủng (gấp 5 đến 6 lần). Trong trường hợp stress ethanol, tăng gấp 4-5 lần so với các chủng có chứa các vector trống đã được phát hiện cho HSP26 trong chủng ICV27 và cho YHR087W trong chủng ICV16. Xác định mức độ tác động trên cấp độ mRNA của những gen này, RNA được phân lập sau 2h phản ứng trong ethanol 10% hoặc glucose 25%. Các RNA được phân tích bởi Northern blot trong trường hợp của HSP26. Vì mức độ biểu hiện của YHR087W thấp nên sử dụng Real Time PCR để phát hiện và định lượng. Bảng A của hình.3.2.2 trình bày các kết quả thu được trong các phân tích này. Ở nồng độ glucose 25% một sự biểu hiện quan trọng của gen HSP26 đã được tìm thấy trong cả hai chủng (gấp 5 đến 6 lần). Trong trường hợp stress ethanol, tăng gấp 4-5 lần so với các chủng có chứa các vector trống đã được phát hiện cho HSP26 trong chủng ICV27 và cho YHR087W trong chủng ICV16. Khả năng phản ứng với các điều kiện stress, khả năng tồn tại của các chủng theo các điều kiện đã được sử dụng cho việc phân tích RNA. Các dữ liệu được cung cấp trong hình.3.2.2 bảng B. Kết quả chỉ ra rằng đối với ICV16, YHR087W tăng khả năng kháng ethanol, trong khi đó HSP26 không ảnh hưởng đến khả năng sống. Đối với ICV27, khả năng tồn tại là cao trong hai biến đổi dưới các điều kiện stress. Tất cả những dữ liệu này chứng minh rằng một trong những thao tác nâng cao sức đề kháng stress, chủ yếu ở ICV27, các chủng cho thấy thiếu hụt trong quá trình lên men rượu và sức đề kháng kém đối với một số các điều kiện stress đặc thù (Zuzuarregui và del Olmo, 2004a)[22]. Những thao tác kỹ thuật này đã cung cấp một số thuận lợi trong phản ứng của các chủng trong điều lên men rượu. Kết quả thu được sau 27 ngày kể từ khi bắt đầu lên men rượu, và chỉ ra rằng chủng ICV27 không có khả năng duy trì số lượng plasmid. Theo đó, chỉ những phương pháp lên men rượu tiến hành trên chủng ICV16 dưới một số nhiệt độ (16, 22, 30 ° C) và nồng độ đường (chứa 200-250g/l đường được bổ sung với 50 g / l của glucose ). Các kết quả thu được cho thấy mức độ tiêu thụ đường trong những phương pháp lên men rượu thực hiện tại 22°C trong hèm Sauvignon blanc (Requena, 2004) đã cao hơn trong nửa đầu của tiến trình trên chủng mang biểu hiện của YHR087W. 3.2.3 Hiệu quả của việc đưa gen HSP26 và YHR087W vào một centromeric plasmid dưới sự kiểm soát của promoter nó. Để tăng tính ổn định plasmid trong chủng ICV27, các gen HSP26 và YHR087W đã được đưa vào centromeric plasmid pRS316, chứa URA3 marker. Chủng ICV27 ura3- biến đổi với các plasmid tương ứng, bao gồm vecto, để tạo nên các chủng ICV27/pRS316, ICV27/pRSHSP26 và ICV27 /pRSYHR087W. Hình 3.2.3 : Tác động của việc gắn HSP26 và YHR087W vào centromeric plasmid pRS316 lên chung ICV27 biểu hiện gen, stress thẩm thấu và khả năng lên men [22]. Phân tích Northern blot và RT-PCR cho thấy chỉ những thay đổi nhỏ hoặc không có sự thay đổi trong cấp độ mRNA của những gen này trong các chủng biến đổi dưới điều kiện stress thẩm thấu gây ra bởi stress glucose 25% (Hình 3.2.3A). Mặc dù vậy, sức kháng của các chủng này với các điều kiện stress được tăng lên (Hình 3.2.3B). Việc cải tiến tính kháng stress với những thao tác này có thể dẫn đến một thuận lợi thế trong khả năng lên men. Trong điều kiện lên men, plasmid mất đi không cao hơn 25%, dẫn tới plasmid này duy trì trạng thái cân bằng tốt hơn ở chủng này dưới điều kiện phát triển không chọn lọc tốt hơn so với các phiên bản bản sao. Khả năng lên men được phân tích bằng cách sử dụng hèm Macabeo (Requena, 2007 ) và theo các điều kiện giống như trong trường hợp của các chủng ICV16 với centromeric plasmid(plasmid mạch đôi DNA được tách từ nhiễm sắc thể của DNA). Theo bảng C trong Hình 3.2.3 cho thấy, sự biểu hiện của YHR087W trong các centromeric plasmid dẫn đến thời gian lên men giảm 37 ngày trong quá trình lên men thực hiện tại 22°C mà không bổ sung đường. Khi nồng độ glucose 50mg/l, quá trình lên men trong chủng đó cũng tiến hành nhanh hơn so với ban đầu. 3.2.4 Ảnh hưởng của sự thay thế promoter HSP26 hoặc YHR087W bằng promoter của gen SPI1. Hình 3.2.4: Sự thay thế thích hợp promoter của gen HSP26 và YHR087W trên chủng ICV16 và ICV27 bằng promoter SPI1 [22]. Những thay đổi các biểu hiện của gen HSP26 và YHR087W bao gồm sự thay thế một bản sao di truyền của promoter của một trong những gen này bằng promoter của gen SPI1, mà mã hóa cho một protein thành tế bào chưa biết chức năng. Theo kết quả trước đây việc sử dụng các promoter này cho phép biểu hiện điều hòa stress của gen tiến tới đầu 3’. Hình 3.2.4A cho thấy rằng thao tác này với các gen HSP26, dẫn đến tăng biểu hiện của nó trong cả hai chủng trong khoảng 2-3 lần dưới điều kiện stress ethanol và thẩm thấu. Kết quả này tăng ổn định (khoảng 120%) trong khả năng tồn tại của các chủng biến đổi (Hình 3.2.4B). Với YHR087W, thao tác này có tác dụng tích cực đáng kể đến sự biểu hiện gen theo điều kiện stress ethanol (đặc biệt là trong chủng ICV27), tăng ở một mức độ vừa phải dưới các điều kiện này. Đối với quá trình lên men (Hình 3.2.4C) trong chủng ICV16, thay thế các promoter của YHR087W, trong một bản sao di truyền của chúng bằng promoter của SPI1 đưa đến kết quả trong việc tiêu thụ lượng đường cao hơn trong suốt 8 ngày đầu tiên trong phương pháp lên men rượu thực hiện trong hèm Macabeo (Requena , 2007) có chứa 200g/l đường[22]. 3.2.5 Ảnh hưởng của thay thế các promoter YHR087W bởi promoter của gen PPGK1 bởi một trong những bản sao di truyền của nó Cải thiện tập tính lên men , ảnh hưởng của việc thay thế promoter của gen YHR087W bởi một trong những bản sao di truyền của nó cho promoter của gen PGK1.Theo các điều kiện stress thử nghiệm (Hình 3.2.5A), sự biểu hiện của gen này tăng từ 10 đến 40 lần trong trường hợp của chủng ICV16 và 3-7 lần cho ICV27, mặc dù chỉ có khả năng chống stress ethanol gia tăng trong cả hai chủng (với sự khác biệt ý nghĩa thống kê trong ICV16) với thao tác này (Hình 3.2.5B)[22]. Hình 3.2.5: Sự thay thế thích hợp promoter của HSP26 và YHR087W bằng PGK1 trên cả hai chủng ICV16 và ICV27 [22]. Chương 4: Bàn luận và hướng phát triển CHƯƠNG 4: BÀN LUẬN VÀ HƯỚNG PHÁT TRIỂN 4.1.Bàn luận Trong tất cả các bước sản xuất rượu vang, tế bào liên tục bị ảnh hưởng bởi nhiều điều kiện stress như stress thẩm thấu, sự oxy hóa, điều kiện pH thấp,thiếu chất dinh dưỡng, và stress ethanol. Một số nghiên cứu đã chỉ ra rằng các tế bào nấm men có thể đáp ứng với những điều kiện bất lợi thông qua những thay đổi trong biểu hiện của nhiều gen trong suốt toàn bộ quá trình lên men (Marks et al.., 2008; Mendes-Ferreira et al., 2007; Rossignol et al, 2003;). Bên cạnh đó, một số điểm tương quan giữa kháng stress, biểu hiện gen và phản ứng lên men đã cho thấy khả năng thích ứng với các điều kiện stress là một tiêu chí cho việc lựa chọn của nấm men rượu vang (Zuzuarregui và del Olmo, 2004a, b; Zuzuarregui et al., 2006)[19]. Sự biểu hện của gen chịu nhiều tác động của các yếu, các gen có những chức năng riêng biệt và chịu trách nhiệm đảm nhận những qui luât quan trọng trong cơ chế đáp ứng các điều kiện stress của tế bào[18]. Sự hiểu biết tốt hơn về cơ chế phản ứng stress và một số kỹ thuật di truyền đã được thực hiện ở nấm men rượu vang với sức kháng được cải thiện đối với các điều kiện bất lợi xảy ra trong quá trình sản xuất rượu vang. Làm tăng tốc độ trong giai đoạn lên men tĩnh, nâng cao khả năng tồn tại trong điều kiện thiếu glucose[19]. Những biểu hiện của các nhân tố phiên mã Msn2p, tham gia vào phản ứng stress, có thể được điều chỉnh để tạo sự cải tiến trong tính kháng stress và khả năng lên men (Cardona et al., 2007). Ảnh hưởng của các thao tác di truyền với một tác động nhỏ trong phiên mã nấm men, tập trung vào hai gen stress đặc biệt: HSP26 và YHR087W. Sử dụng kết hợp bốn phương thức khác nhau: sự biểu hiện trong espisomal plasmid hoặc centromeric plasmid dưới sự đối chứng của promoter của chúng và thay thế của các promoter của các gen này ở bản sao di truyền của chúng cho promoter của gen SPI1 hoặc PGK1. Những thác tác di truyền trên chủng ICV27 có nhiều khó khăn, không thể duy trì được sự ổn định trong espisomal plasmid (không phải trên vector). Tuy nhiên, nó đã có thể gắn và duy trì ổn định centromeric plasmid hoặc hiệu chỉnh trong bộ gen. Các thao tác di truyền dẫn đến tăng biểu hiện của các gen. Bên cạnh đó, các chủng biến đổi trong một số trường hợp có nhiều khả năng chống lại các điều kiện bất lợi: stress thẩm thấu gây ra bởi nồng độ đường cao và stress ethanol. Một số chủng có thể cải thiện khả năng lên men, và những tác động này phụ thuộc vào loại hèm tự nhiên được sử dụng, nhiệt độ tăng trưởng và nồng độ đường ban đầu. Vai trò quan trọng của gen YHR087W là có khả năng chịu được nồng độ glucose cao và các điều kiện stress khác, và sự đột biến của nó cho thấy sự tăng trưởng bị bất hoạt trong môi trường YPD chứa glucose 25%. Sự điều tiết phản ứng stress trong nấm men rượu vang ảnh hưởng đến khả năng lên men, nhưng rất khó để dự đoán tác động cụ thể vào từng trường hợp nên các nghiên cứu cần được thử nghiệm cẩn thận. Trong một số trường hợp các thao tác di truyền thực hiện dường như không mang lại kết quả ở điều kiện nồng độ đường cao hoặc không kể sức kháng với điều kiện stress này và khả năng lên men cải thiện được nhận thấy. Các kết quả này có thể được giải thích bởi thời điểm phản ứng được quyết định của cảm ứng trong các điều kiện stress; như dưới điều kiện sốc nhiệt hoặc nồng độ glucose cao cảm ứng xảy ra rất nhanh chóng và cấp độ sự biểu hiện ở cấp độ mRNA khoảng 2-6 lần giữa 30 phút và 2h sau khi tác động những điều kiện bất lợi (Gasch et al., 2000; Kaeberlein et al, 2002.), đây là thời gian được xem xét trong các thí nghiệm. Việc cải tiến được tìm thấy trong phương pháp lên men rượu có thể được giải thích bởi rất nhiều điều kiện stress diễn ra đồng thời hoặc theo một trình tự. Mặt khác, khi promoter YHR087W được thay thế bằng promoter của SPI1 và thí nghiệm trong môi trường chứa 25% glucose, không có sự gia tăng cấp độ mRNA nào được tìm thấy trong bất kỳ chủng nào. Cuối cùng, trong các thao tác khác (ví dụ, trong biểu hiện của HSP26 ở espisomal plasmid trong chủng ICV16 hoặc trong centromeric plasmid trong chủng ICV27), các cấp độ mRNA tăng nhưng khả năng tồn tại trong điều kiện stress đặc biệt là không được cải thiện, cho thấy rằng các thao tác của một gen cụ thể là không đủ để có được một hiệu ứng tích cực trong tính năng này. Điều thú vị, khi các promoter PGK1 được xem xét, sự biểu hiện của YHR087W tăng lên, nhưng điều này đã không mang lại bất cứ cải tiến trong khả năng lên men, có lẽ vì sự thiếu kiểm soát thời gian chính xác trong biểu hiện trong suốt quá trình lên men. Theo đó, việc sử dụng điều hòa của một promoter mạnh với các biểu hiện thấp hơn ở những giai đoạn thuận lợi của quá trình, như PGK1, không thích hợp để thay đổi các cấp độ mRNA của gen stress với mục đích cải thiện khả năng lên men. Mặc dù có nhiều thí nghiệm đạt được một sự hiểu biết tốt hơn về cách cải thiện khả năng lên men trên cơ sở biểu hiện các thao tác trên gen kháng stress. Bên cạnh đó, cũng đã cung cấp một số hướng đi thú vị, trong đó có sự liên quan của việc sử dụng các promoter SPI1 cho việc kiểm soát sự biểu hiện của gen stress . 4.2 Hướng phát triển. 4.2.1 Phát triển dựa trên các phương pháp kiểm soát tối ưu điều kiện lên men. Quá trình lên men rượu là một quá trình phức tạp đòi hỏi, yêu cầu kỹ thuật của người sản xuất cao. Trong bài báo cáo này đã đề cấp tới những yếu tố thiết yếu ảnh hưởng trực tiếp lên quá trình lên men đặc biệt là : theo dõi sự sinh trưởng, phát triển của nấm men saccharomyces cerevisiea qua từng giai đoạn của quá trình lên men, những tác động ảnh hưởng đến chất lượng rượu và khả năng lên men của nấm men dưới các điều kiện ảnh hưởng. Những kết quả thu được phần nào đánh giá được tầm quan trọng của việc kiểm soát các yếu tố ảnh hưởng lên quá trình lên men. Đồng thời bên cạnh đó còn mở ra hướng phát triển để cải thiện kỹ thuật lên men rượu. Kiểm soát quá trình sản xuất để tạo ra hàm lượng ethanol là tối ưu, bên cạnh đó là chất lượng của rượu thành phẩm. Do đó phương pháp kiểm soát tối ưu các điều kiện lên men trở nên hữu hiệu vì có nhiều ưu điểm như : không sử dụng máy móc trang thiết bị đắt tiền,dễ dàng thực hiện, việc tiến hành các thí nghiệm để tối ưu điều kiện lên men nhanh. 4.2.2 Phát triển dựa trên việc cải tiến hệ gen của chủng nấm men Saccharomyces cerevisiae. Sự cải tiến hệ gen của nấm men là một quá trình nghiên cứu lâu dài, liên quan tới nhiều yếu tố ảnh hưởng đến sự sinh trưởng và khả năng lên men của chủng nấm men. Những kết quả thu được trên 2 gen HSP26 và YHR087W đã cho thấy một bước tiến quan trọng trong lĩnh vực sinh học phân tử. Việc cải thiện khả năng lên men, khả năng kháng các điều kiện bất lợi đối với nấm men đã chỉ ra rằng kỹ thuật di truyền trên các đoạn gen qui định những tính chất trên đã mang lại hiệu quả. Bên cạnh đó nguồn gen được di truyền từ thế hệ này sang thế hệ khác, vì vậy trở thành một điểm lợi thế mà kỹ thuật kiểm soát tối ưu các điều kiện lên men không có được. Phương pháp này có nhiều ưu điểm vượt trội: Tạo được chủng nấm men saccharomyces cerevisiae có khả năng lên men tạo ethanol ở nồng độ cao, cải thiện khả năng lên men, chịu được các điều kiện cực đoan của môi trường( áp thẩm thấu, các acid hữu cơ, nhiệt độ…). Mặc dù, phương pháp này đòi hỏi kỹ thuật cao, người kỹ sư phải có kiến thức chuyên môn về lĩnh vực sinh học phân. Trên đây là hai hướng phát triển, tùy theo yêu cầu và mục đích mà người kỹ sư có lựa chọn hợp lý. Hiện nay trên thế giới việc cải tiến hệ gen ngày càng được phát triển vì nó mang lại lợi ích lâu dài cho công nghệ sản xuất rượu vang, tế bào nấm men có khả năng chịu được các điều kiện bất lợi mà vẫn tạo ra những sản phẩm rượu vang chất lượng. Vì vậy ở Việt Nam việc cải tiến hệ gen của nấm men là một bước tiến quan trọng và cấp thiết để tạo ra những giống nấm men đạt được yêu cầu trong sản xuất rượu vang, bên cạnh đó phát triển được ngành công nghệ sinh học nước nhà đặc biệt là lĩnh vực sinh học phân tử. Tài liệu tham khảo: Tài liệu trong nước: [1] Phạm Văn Ty, Vũ Nguyên Thành.,2009. Công nghệ sinh học tập 5: Công nghệ vi sinh và môi trường. Nhà xuất bản Giáo Dục.176 trang. [2] Bùi Ái.2002. Công nghệ lên men ứng dụng trong công nghệ thực phẩm. Nhà xuất bản Đại học Quốc gia TP.HCM. trang. [3] Lê Văn Việt Mẫn, Nguyễn Quốc Đạt, Nguyễn Thị Hiền, Tôn Nữ Minh Nguyệt, Trần Thị Thu Trà.,2010. Công nghệ chế biến thực phẩm. Nhà xuất bản Đại học quốc gia thành phố Hồ Chí Minh.1019 trang. [4] Ngô Thị Phương Dung,2009. Khảo sát khả năng lên men và tính chịu cồn của nấm men. Tạp chí Khoa học, 11:374-382. [5] Nguyễn Quang Vinh., 2005. Nghiên cứu chế biến rượu vang từ nếp than. Luận văn Thạc sĩ, Đại học Bách Khoa thành phố Hồ Chí Minh. Tài liệu nước ngoài: [6] Ian Hornsey., 2007. The Chemistry and Biology of Winemaking. The Royal Society of Chemistry, Thomas Graham House, Science Park, Milton Road, Cambridge CB4 0WF, UK. 472. [7] Henry C. Vogel, Celeste L. Todaro., 1997. Fermentation and Biochemical Engineering Handbook(1st Edition). Noyes Publications, Park Ridge, New Jeesy,USA. 439. [8] L. Cocolin and D. Ercolini.,2008. Molecular Techniques in the Microbial Ecology of Fermented Foods. Springer Science and Business Media, 233 Spring Street,NY, USA. 280. [9] Mónica Herrero, Luis A. García, and Mario díaz., 2005. The Effect of SO2 on the Production of Ethanol, Acetaldehyde,Organic Acids, and Flavor Volatiles during Industrial Cider Fermentation. Journal of Agricultural and Food Chemitry, 51: 3455-3459. [10] María Jesus Torija, Gemma Beltran, Maite Novo, Montse Poblet, Nicolas Rozès, Albert Mas, and José Manuel Guillamón., 2003. Effect of Organic Acids and Nitrogen Source on Alcoholic Fermentation: Study of Their Buffering Capacity. Journal of Agricultural and Food Chemitry, 51:916-922. [11] Josep M. Llauradoa, Nicolas Rozés, Magda Constantia, and Alberto Mas., 2005. Study of Some Saccharomyces cerevisiae Strains for Winemaking after Preadaptation at Low Temperatures. Journal of Agricultural and Food Chemitry, 53:1003-1011. [12] Trong Khoa Pham, Poh Kuan Chong, Chee Sian Gan, and Phillip C. Wright., 2006. Proteomic Analysis of Saccharomyces cerevisiae under High Gravity Fermentation Conditions. Journal of Proteome Research,5 : 3411-3419. [13] Jaime Aguilera, Thomas Petit, Johannes H. de Winde, Jack T. Pronk., 2005. Physiological and genome-wide transcriptional responses of Saccharomyces cerevisiae to high carbon dioxide concentrations. FEMS Yeast Research, 5:579-593. [14] Leilah E. Backhus, Joseph DeRisi, Patrick O. Brown, Linda F. Bisson.,2001. Functional genomic analysis of a commercial wine strain of Saccharomyces cerevisiae under differing nitrogen conditions. FEMS Yeast Research, 1:111-125. [15] Francisco J. Pizarro, Michael C. Jewett, Jens Nielsen,and Eduardo Agosin., 2008. Growth Temperature Exerts Differential Physiological and Transcriptional Responses in Laboratory and Wine Strains of Saccharomyces cerevisiae. Applied and Environmental Microbiology, 74:6358–6368. [16] Ronald E. Susek and Susan L. Lindquist.,1989. hsp26 of Saccharomyces cerevisiae Is Related to the Superfamily of Small Heat Shock Proteins but Is without a Demonstrable Function. Molecular And Cellular Biology,9:5265-5271 [17] Renato Marins Ferreira, Leonardo Rodrigues de Andrade, Márcio Barros Dutra, Marcos Farina de Souza, Vânia Margaret Flosi Paschoalin, Joab Trajano Silva.,2006. Purification and characterization of the chaperone-like Hsp26 from Saccharomyces cerevisiae. Protein Expression and Purification, 47:384-392. [18] H. Alexandre, V. Ansanay-Galeote, S. Dequin, B. Blondin., 2001. Global gene expression during short-term ethanol stress in Saccharomyces cerevisiae. FEBS Letters, 498:98-103. [19] Takayuki Homma, Hitoshi Iwahashi, and Yasuhiko Komatsu.,2003. Yeast gene expression during growth at low temperature. Cryobiology, 46:230–237. [20] A. Mendes-Ferreira, M. del Olmo,J. García-Martínez, E. Jiménez-Martí,C. Leão, A. Mendes-Faia, and J. E. Pérez-Ortín., 2007. Saccharomyces cerevisiae Signature Genes for Predicting Nitrogen Deficiency during Alcoholic Fermentation. Applied and Environmental Microbiology, 73:5363-5369. [21] Elke Nevoigt.,2008. Progress in Metabolic Engineering of Saccharomyces cerevisiae. Microbiology and Molecular Biology Reviews,72:379–412. [22] E. Jiménez-Martí, A. Zuzuarregui, I. Ridaura, N. Lozano, M. del Olmo., 2009. Genetic manipulation of HSP26 and YHR087W stress genes may improve fermentative behaviour in wine yeasts under vinification conditions. International Journal of Food Microbiology, 130:122–130. [23] Thusnelda Stromer, Elke Fischer, Klaus Richter, Martin Haslbeck, and Johannes Buchner., 2004. Analysis of the regulation of the molecular chaperone hsp26 by temperature-induced dissociation: the n-terminal domain is important for oligomer assembly and the binding of unfolding proteins. The Journal Of Biological Chemistry. 279:11222–11228. [24] Jin Chen., 2010.Regions Outside the α-Crystallin Domain of the Small Heat Shock Protein Hsp26 Are Required for Its Dimerization. J. Mol. Biol, 398:122–131. [25] Titus M. Franzmann et al, 2005. The Activation Mechanism of Hsp26 does not Require Dissociation of the Oligomer. J. Mol. Biol, 350:1083–1093. [26]S. Rahaie, Z. Emam-Djomeh, S. H. Razavi, M. Mazaheri., 2010. Immobilized Saccharomyces Cerevisiae as a potential aflatoxin decontaminating agent in pistachio nuts. Brazilian Journal of Microbiology, 41:82-90. [27] Mee-Jung Han et al, 2008. Microbial small heat shock proteins and their use in biotechnology. Biotechnology Advances, 26:591–609 [28] Ma. Jesús Torija, Nicolas Rozès, Montse Poblet,José Manuel Guillamón, Albert Mas., 2003. Effects of fermentation temperature on the strain population of Saccharomyces cerevisiae. International Journal of Food Microbiology, 80: 47– 53. Tài liệu Internet: [29] HYPERLINK "" [30] HYPERLINK "" [31] HYPERLINK ""www.yeastgenome.org PHỤ LỤC MÔI TRƯỜNG SỬ DỤNG TRONG CÁC NGHIÊN CỨU Môi trường YPD [19]: -1% (w/v) dịch chiết nấm men ( Yeast extract). -2% (w/v) Polypeptone. -2% (w/v) Dextrose. Môi trường YNB [17]: Yeast Nitrogen Base: -0,67% (w/v) Nguồn Nito nấm men không chứacác amino acid( Hãng Difco cung cấp). -2% (w/v) glucose. - Các chất dinh dưỡng cần thiết.

Các file đính kèm theo tài liệu này:

  • docKy thuat tren Saccharomyces.doc
  • pdfKy thuat tren Saccharomyces.pdf
  • pptKy thuat tren Saccharomyces.ppt