Luận án Nghiên cứu đa dạng và sinh tổng hợp Cyclooligomer Depsipeptide của nấm ký sinh côn trùng tại khu bảo tồn thiên nhiên Copia và vườn quốc gia Xuân Sơn

n and studies on precursor-directed biosynthesis", Tetrahedron, 59(7), pp. 1015-1020. 125. Nilanonta C., Isaka M., Kittakoop P., Palittapongarnpim P., Kamchonwongpaisan S., Pittayakhajonwut D., Tanticharoen M., Thebtaranonth Y. (2000), "Antimycobacterial and antiplasmodial cyclodepsipeptides from the insect pathogenic fungus Paecilomyces tenuipes BCC 1614", Planta medica, 66(08), pp. 756-758. 126. Nilanonta C., Isaka M., Kittakoop P., Trakulnaleamsai S., Tanticharoen M., Thebtaranonth Y. (2002), "Precursor-directed biosynthesis of beauvericin analogs by the insect pathogenic fungus Paecilomyces tenuipes BCC 1614", Tetrahedron, 58(17), pp. 3355-3360. 127. Niu X., Xie W., Zhang J., Hu Q. (2019), "Biodiversity of entomopathogenic fungi in the soils of South China", Microorganisms, 7(9), pp. 311. 128. Ohshiro T., Matsuda D., Kazuhiro T., Uchida R., Nonaka K., Masuma R., Tomoda H. (2012), "New verticilides, inhibitors of acyl-CoA: cholesterol acyltransferase, produced by Verticillium sp. FKI-2679", The Journal of antibiotics, 65(5), pp. 255. 129. Ohyama M., Okada Y., Takahashi M., Sakanaka O., Matsumoto M., Atsumi K. (2011), "Structure-activity relationship of anthelmintic cyclooctadepsipeptides", Bioscience, biotechnology, and biochemistry, 75(7), pp. 1354-1363. 130. Olatunji O. J., Tang J., Tola A., Auberon F., Oluwaniyi O., Ouyang Z. (2018), "The genus Cordyceps: An extensive review of its traditional uses, phytochemistry and pharmacology", Fitoterapia, 129, pp. 293-316. 131. Olleik H., Nicoletti C., Lafond M., Courvoisier-Dezord E., Xue P., Hijazi A., Baydoun E., Perrier J., Maresca M. (2019), "Comparative Structure–Activity Analysis of the Antimicrobial Activity, Cytotoxicity, and Mechanism of Action of the Fungal Cyclohexadepsipeptides Enniatins and Beauvericin", Toxins, 11(9), pp. 514. 132. Park S. J., Hyun S.-H., Suh H. W., Lee S.-Y., Sung G.-H., Kim S. H., Choi H.-K. (2013), "Biochemical characterization of cultivated Cordyceps bassiana mycelia and fruiting bodies by 1 H nuclear magnetic resonance spectroscopy", Metabolomics, 9(1), pp. 236-246. 133. Paszkiewicz M., Tyma M., Ligeza-Zuber M., Włóka E., Bogus M., Stepnowski P. (2017), "Mycotoxin production by entomopathogenic fungus Conidiobolus coronatus", Int. J. Environ. Agric. Res, 3, pp. 33-40. 134. Pedras M. S. C., Zaharia L. I., Ward D. E. (2002), "The destruxins: synthesis, biosynthesis, biotransformation, and biological activity", Phytochemistry, 59(6), pp. 579-596. 135. Peeters H., Zocher R., Madry N., Kleinkauf H. (1983), "Incorporation of radioactive precursors into beauvericin produced by Paecilomyces fumosoroseus", Phytochemistry, 22(8), pp. 1719-1720. 136. Permadi M., Samosir B., Siregar D., Wayni M. (2020), Physiology Characterization of Entomopathogenic Fungi Beauveria bassiana and Metarhizium anisopliae on Different Carbohydrate Sources, Journal of Physics: Conference Series, IOP Publishing, pp. 072007. 137. Pettit R. K., Pettit G. R., Xu J. P., Weber C. A., Richert L. A. (2010), "Isolation of human cancer cell growth inhibitory, antimicrobial lateritin from a mixed fungal culture", Planta medica, 76(05), pp. 500-501. 138. Pohanka A., Capieau K., Broberg A., Stenlid J., Stenström E., Kenne L. (2004), "Enniatins of Fusarium sp. Strain F31 and Their Inhibition of Botrytis c inerea Spore Germination", Journal of natural products, 67(5), pp. 851-857. 139. Rachmawati R., Kinoshita H., Nihira T. (2017), "Production of Insect Toxin Beauvericin from Entomopathogenic Fungi Cordyceps militaris by Heterologous Expression of Global Regulator", Agrivita, Journal of Agricultural Science, 40(1), pp. 177-184. 140. Ramakuwela T., Hatting J., Bock C., Vega F. E., Wells L., Mbata G. N., Shapiro-Ilan D. (2020), "Establishment of Beauveria bassiana as a fungal endophyte in pecan (Carya illinoinensis) seedlings and its virulence against pecan insect pests", Biological Control, 140, pp. 104102. 141. Rangel M., José Correia de Santana C., Pinheiro A., dos Anjos L., Barth T., Rodrigues Pires Júnior O., Fontes W., S Castro M. (2017), "Marine depsipeptides as promising pharmacotherapeutic agents", Current Protein and Peptide Science, 18(1), pp. 72-91. 142. Rehner S. A., Samuels G. J. (1994), "Taxonomy and phylogeny of Gliocladium analysed from nuclear large subunit ribosomal DNA sequences", Mycological Research, 98(6), pp. 625-634. 143. Ríos-Moreno A., Garrido-Jurado I., Resquín-Romero G., Arroyo-Manzanares N., Arce L., Quesada-Moraga E. (2016), "Destruxin A production by Metarhizium brunneum strains during transient endophytic colonisation of Solanum tuberosum", Biocontrol science and technology, 26(11), pp. 1574-1585. 144. Rippke F., Berardesca E., Weber T. M. (2018), "pH and Microbial Infections", Current problems in dermatology, 54, pp. 87-94. 145. Roskov Y., Ower G., Orrell T., Nicolson D., Bailly N., Kirk P.M., Bourgoin T., DeWalt R.E., Decock W., Nieukerken E. van, Zarucchi J., Penev L. e. (2019), Species 2000 & ITIS Catalogue of Life, 2019 Annual Checklist, chủ biên, Digital resource at www.catalogueoflife.org/annual-checklist/2019. Species 2000: Naturalis, Leiden, the Netherlands. ISSN 2405-884X. 146. Rózsa M., Apahidean M. (2020), "Influence of temperature and pH level on mycelial growth in liquid cultures of Cordyceps militaris mushroom", Current Trends in Natural Sciences, 9(18), pp. 42-46. 147. Sangdee A., Sangdee K. (2013), "Isolation, identification, culture and production of adenosine and cordycepin from Cicada larva infected with entomopathogenic fungi in Thailand", African Journal of Microbiology Research, 7(2), pp. 137-146. 148. Santi L., Coutinho-Rodrigues C. J., Berger M., Klein L. A., De Souza E. M., Rosa R. L., Guimarães J. A., Yates J. R., Perinotto W. M., Bittencourt V. R. (2019), "Secretomic analysis of Beauveria bassiana related to cattle tick, Rhipicephalus microplus, infection", Folia microbiologica, 64(3), pp. 361-372. 149. Santos D. S., Diniz A. C., Tiago A. G., Vieira P., Oliveira D., Tinti N. (2020), "Entomopathogenic Fusarium species: a review of their potential for the biological control of insects, implications and prospects", Fungal Biology Reviews, 34(1), pp. 41-57. 150. Sasaki T., Takagi M., Yaguchi T., Miyadoh S., Okada T., Koyama M. (1992), "A new anthelmintic cyclodepsipeptide, PF1022A", The Journal of antibiotics, 45(5), pp. 692-697. 151. Sato T., Ishiyama D., Honda R., Senda H., Konno H., Tokumasu S., Kanazawa S. (2000), "Glomosporin, a Novel Antifungal Cyclic Depsipeptide from Glomopora sp", The Journal of antibiotics, 53(6), pp. 597-602. 152. Schoch C. L., Seifert K. A., Huhndorf S., Robert V., Spouge J. L., Levesque C. A., Chen W., Consortium F. B. (2012), "Nuclear ribosomal internal transcribed spacer (ITS) region as a universal DNA barcode marker for Fungi", Proceedings of the National Academy of Sciences, 109(16), pp. 6241-6246. 153. Sebastià N., Meca G., Soriano J. M., Mañes J. (2011), "Antibacterial effects of enniatins J1 and J3 on pathogenic and lactic acid bacteria", Food and chemical toxicology, 49(10), pp. 2710-2717. 154. Shimazu M. (2001), "Paecilomyces cateniannulatus Liang, a commonly found, but an unrecorded entomogenous fungus in Japan", Applied Entomology and Zoology, 36(3), pp. 283-288. 155. Shin C. G., An D. G., Song H. H., Lee C. (2009), "Beauvericin and enniatins H, I and MK1688 are new potent inhibitors of human immunodeficiency virus type-1 integrase", The Journal of antibiotics, 62(12), pp. 687. 156. Shiono Y., Tsuchinari M., Shimanuki K., Miyajima T., Murayama T., Koseki T., Laatsch H., Funakoshi T., Takanami K., Suzuki K. (2007), "Fusaristatins A and B, two new cyclic lipopeptides from an endophytic Fusarium sp", The Journal of antibiotics, 60(5), pp. 309. 157. Shrestha B., Tanaka E., Hyun M. W., Han J.-G., Kim C. S., Jo J. W., Han S.-K., Oh J., Sung G.-H. (2016), "Coleopteran and lepidopteran hosts of the entomopathogenic genus Cordyceps sensu lato", Journal of Mycology, 2016. 158. Sieber S. A., Marahiel M. A. (2005), "Molecular mechanisms underlying nonribosomal peptide synthesis: approaches to new antibiotics", Chemical reviews, 105(2), pp. 715-738. 159. Sikder M. M., Mallik M. R. I., Alam N. (2019), "Identification and in vitro Growth Characteristics of Entomopathogenic fungus-Aschersonia sp. in Bangladesh". 160. Sivanathan S., Scherkenbeck J. (2014), "Cyclodepsipeptides: A rich source of biologically active compounds for drug research", Molecules, 19(8), pp. 12368-12420. 161. Smedsgaard J. (1997), "Micro-scale extraction procedure for standardized screening of fungal metabolite production in cultures", Journal of Chromatography A, 760(2), pp. 264-270. 162. Song H. H., Lee H. S., Jeong J. H., Park H. S., Lee C. (2008), "Diversity in beauvericin and enniatins H, I, and MK1688 by Fusarium oxysporum isolated from potato", International journal of food microbiology, 122(3), pp. 296-301. 163. Sood S., Sandhu S., Mukherjee T. (2017), "Pharmacological and Therapeutic Potential of Beauvericin: A Short Review", J Proteomics Bioinform, 10(1), pp. 18-23. 164. Steiniger C., Hoffmann S., Mainz A., Kaiser M., Voigt K., Meyer V., Süssmuth R. D. (2017), "Harnessing fungal nonribosomal cyclodepsipeptide synthetases for mechanistic insights and tailored engineering", Chemical science, 8(11), pp. 7834-7843. 165. Sung G. H., Hywel-Jones N. L., Sung J.-M., Luangsa-Ard J. J., Shrestha B., Spatafora J. W. (2007), "Phylogenetic classification of Cordyceps and the clavicipitaceous fungi", Studies in mycology, 57, pp. 5-59. 166. Sung G. H., Sung J. M., Hywel-Jones N. L., Spatafora J. W. (2007), "A multi-gene phylogeny of Clavicipitaceae (Ascomycota, Fungi): identification of localized incongruence using a combinational bootstrap approach", Molecular phylogenetics and evolution, 44(3), pp. 1204-1223. 167. Supothina S., Isaka M., Kirtikara K., Tanticharoen M., Thebtaranonth Y. (2004), "Enniatin production by the entomopathogenic fungus Verticillium hemipterigenum BCC 1449", The Journal of antibiotics, 57(11), pp. 732-738. 168. Supothina S., Srisanoh U., Nithithanasilp S., Tasanathai K., Luangsa-Ard J. J., Li C.-R., Isaka M. (2011), "Beauvericin production by the Lepidoptera pathogenic fungus Isaria tenuipes: Analysis of natural specimens, synnemata from cultivation, and mycelia from liquid-media fermentation", Natural products and bioprospecting, 1(3), pp. 112-115. 169. Süssmuth R., Müller J., Von Döhren H., Molnár I. (2011), "Fungal cyclooligomer depsipeptides: from classical biochemistry to combinatorial biosynthesis", Natural product reports, 28(1), pp. 99-124. 170. Süssmuth R. D., Mainz A. (2017), "Nonribosomal peptide synthesis - principles and prospects", Angewandte Chemie International Edition, 56(14), pp. 3770-3821. 171. Sy-Cordero A. A., Pearce C. J., Oberlies N. H. (2012), "Revisiting the enniatins: a review of their isolation, biosynthesis, structure determination and biological activities", The Journal of antibiotics, 65(11), pp. 541. 172. Hung L. T., Hanh V. T., Phuong L. T. B. , Phong T. T. , Van T. T. H., Sivichai S. (2010), "Entomopathogenic fungi at Cat Tien National Park: The potential materials for biological application", Scientific Conference celebrates 35 years of Vietnam Academy of Science and Technology. 173. Taevernier L., Wynendaele E., Gevaert B., De Spiegeleer B. (2017), "Chemical classification of cyclic depsipeptides", Current Protein and Peptide Science, 18(5), pp. 425-452. 174. Thomas M. B., Read A. F. (2007), "Fungal bioinsecticide with a sting", Nature Biotechnology, 25(12), pp. 1367-1368. 175. Thompson J. D., Gibson T. J., Plewniak F., Jeanmougin F., Higgins D. G. (1997), "The CLUSTAL_X windows interface: flexible strategies for multiple sequence alignment aided by quality analysis tools", Nucleic acids research, 25(24), pp. 4876-4882. 176. Tian J., Han J. J., Zhang X., He L. W., Zhang Y. J., Bao L., Liu H. W. (2016), "New Cyclohexadepsipeptides from an Entomogenous Fungus Fusarium proliferatum and Their Cytotoxicity and Autophagy‐Inducing Activity", Chemistry & biodiversity, 13(7), pp. 852-860. 177. Tomoda H., Nishida H., Huang X. H., Masuma R., Kim Y. K., Omura S. (1992), "New cyclodepsipeptides, enniatins D, E and f produced by Fusarium sp. FO-1305Áü", The Journal of antibiotics, 45(8), pp. 1207-1215. 178. Tzean S. (1997), Atlas of Entomopathogenic Fungi from Taiwan: Department of Plant Pathology and Entomology, National Taiwan University, Taipei, Taiwan, 10617, ROC, Council of agriculture, executive yuan. 179. Uhlig S., Ivanova L., Petersen D., Kristensen R. (2009), "Structural studies on minor enniatins from Fusarium sp. VI 03441: novel N-methyl-threonine containing enniatins", Toxicon, 53(7-8), pp. 734-742. 180. Umeyama A., Takahashi K., Grudniewska A., Shimizu M., Hayashi S., Kato M., Okamoto Y., Suenaga M., Ban S., Kumada T. (2014), "In vitro antitrypanosomal activity of the cyclodepsipeptides, cardinalisamides A - C, from the insect pathogenic fungus Cordyceps cardinalis NBRC 103832", The Journal of antibiotics, 67(2), pp. 163-166. 181. Urbaniak M., Stępień Ł., Uhlig S. (2019), "Evidence for naturally produced beauvericins containing N-Methyl-Tyrosine in hypocreales fungi", Toxins, 11(3), pp. 182. 182. Urry L. A., Cain M. L., Wasserman S. A., Minorsky P. V., Reece J. B. (2017), Campbell biology, Pearson Education, Incorporated. 183. Valencia J. W. A., Bustamante A. L. G., Jiménez A. V., Grossi-de-Sá M. F. (2011), "Cytotoxic activity of fungal metabolites from the pathogenic fungus Beauveria bassiana: an intraspecific evaluation of beauvericin production", Current microbiology, 63(3), pp. 306. 184. Van N. T. T., Viet N. D., Lam D. M. (2021), "Effects of Culture Conditions on Growth and Cyclooligomer Depsipeptides Biosynthesis of Cordyceps sp. CPA14V", VNU Journal of Science: Natural Sciences and Technology, 38(1). 185. Vanden Berghe D. (1991), "Screening methods for antibacterial and antiviral agents from higher plants", Methods in plant biochemistry, pp. 47-69. 186. Vega F. E. (2018), "The use of fungal entomopathogens as endophytes in biological control: a review", Mycologia, 110(1), pp. 4-30. 187. Vikhe A., Dale N., Umbarkar R., Labade G., Savant A., Walunj A. (2016), "In Vitro and In Vivo induction and characterization of toxins isolated from Beauveria bassiana", International Journal of Pure & Applied Bioscience, 4(3), pp. 97-103. 188. Vilgalys R., Hester M. (1990), "Rapid genetic identification and mapping of enzymatically amplified ribosomal DNA from several Cryptococcus species", Journal of bacteriology, 172(8), pp. 4238-4246. 189. Visconti A., Blais L. A., ApSimon J. W., Greenhalgh R., Miller J. D. (1992), "Production of enniatins by Fusarium acuminatum and Fusarium compactum in liquid culture: isolation and characterization of three new enniatins, B2, B3, and B4", Journal of Agricultural and Food Chemistry, 40(6), pp. 1076-1082. 190. Vongvanich N., Kittakoop P., Isaka M., Trakulnaleamsai S., Vimuttipong S., Tanticharoen M., Thebtaranonth Y. (2002), "Hirsutellide a, a new antimycobacterial cyclohexadepsipeptide from the entomopathogenic fungus hirsutella k obayasii", Journal of natural products, 65(9), pp. 1346-1348. 191. Vongvilai P., Isaka M., Kittakoop P., Srikitikulchai P., Kongsaeree P., Prabpai S., Thebtaranonth Y. (2004), "Isolation and structure elucidation of enniatins L, M1, M2, and N: novel hydroxy analogs", Helvetica chimica acta, 87(8), pp. 2066-2073. 192. Wang C. C., Wu J. Y., Chang C. Y., Yu S. T., Liu Y. C. (2019), "Enhanced exopolysaccharide production by Cordyceps militaris using repeated batch cultivation", Journal of bioscience and bioengineering, 127(4), pp. 499-505. 193. Wang J., Zhang D. M., Jia J. F., Peng Q. L., Tian H. Y., Wang L., Ye W. C. (2014), "Cyclodepsipeptides from the ascocarps and insect-body portions of fungus Cordyceps cicadae", Fitoterapia, 97, pp. 23-27. 194. Wang Q., Xu L. (2012), "Beauvericin, a bioactive compound produced by fungi: a short review", Molecules, 17(3), pp. 2367-2377. 195. Wang X.-L., Yao Y.-J. (2011), "Host insect species of Ophiocordyceps sinensis: a review", ZooKeys, (127), pp. 43. 196. Wang X., Gong X., Li P., Lai D., Zhou L. (2018), "Structural diversity and biological activities of cyclic depsipeptides from fungi", Molecules, 23(1), pp. 169. 197. Wang Y., Ke A., Wang F., Zhang X., Fan Y., Lu X., Zheng Z., Jiang Q., Zhang H., Zhao B. (2011), "F04W2166A, a proteasome inhibitor from fungal metabolites", Chin. J. Antibiot, 9, pp. 662-666. 198. Weckwerth W., Miyamoto K., Iinuma K., Krause M., Glinski M., Storm T., Bonse G., Kleinkauf H., Zocher R. (2000), "Biosynthesis of PF1022A and related cyclooctadepsipeptides", Journal of Biological Chemistry, 275(23), pp. 17909-17915. 199. Weng Q., Zhang X., Chen W., Hu Q. (2019), "Secondary metabolites and the risks of Isaria fumosorosea and Isaria farinosa", Molecules, 24(4), pp. 664. 200. Whittaker R. H. (1969), "New concepts of kingdoms of organisms", Science, 163(3863), pp. 150-160. 201. Xu F. (2018), "Identification and Engineering of Nonribosomal Peptide Biosynthetic Systems". 202. Xu L., Wang J., Zhao J., Li P., Shan T., Wang J., Li X., Zhou L. (2010), "Beauvericin from the endophytic fungus, Fusarium redolens, isolated from Dioscorea zingiberensis and its antibacterial activity", Natural Product Communications, 5(5), pp. 1934578X1000500527. 203. Xu L. J., Liu Y. S., Zhou L. G., Wu J. Y. (2010), "Optimization of a liquid medium for beauvericin production in Fusarium redolens Dzf2 mycelial culture", Biotechnology and Bioprocess Engineering, 15(3), pp. 460-466. 204. Xu Y., Orozco R., Wijeratne E. K., Espinosa-Artiles P., Gunatilaka A. L., Stock S. P., Molnár I. (2009), "Biosynthesis of the cyclooligomer depsipeptide bassianolide, an insecticidal virulence factor of Beauveria bassiana", Fungal Genetics and Biology, 46(5), pp. 353-364. 205. Xu Y., Orozco R., Wijeratne E. K., Gunatilaka A. L., Stock S. P., Molnár I. (2008), "Biosynthesis of the cyclooligomer depsipeptide beauvericin, a virulence factor of the entomopathogenic fungus Beauveria bassiana", Chemistry & biology, 15(9), pp. 898-907. 206. Xu Y., Zhan J., Wijeratne E. K., Burns A. M., Gunatilaka A. L., Molnár I. (2007), "Cytotoxic and antihaptotactic beauvericin analogues from precursor-directed biosynthesis with the insect pathogen Beauveria bassiana ATCC 7159", Journal of natural products, 70(9), pp. 1467-1471. 207. Yang G. Z., Li Y. C. (2002), "Cyclopeptide and Terpenoids from Tripterygium wilfordii Hook", Helvetica chimica acta, 85(1), pp. 168-174. 208. Ye X., Anjum K., Song T., Wang W., Liang Y., Chen M., Huang H., Lian X.-Y., Zhang Z. (2017), "Antiproliferative cyclodepsipeptides from the marine actinomycete Streptomyces sp. P11-23B downregulating the tumor metabolic enzymes of glycolysis, glutaminolysis, and lipogenesis", Phytochemistry, 135, pp. 151-159. 209. Yu D., Xu F., Zhang S., Zhan J. (2017), "Decoding and reprogramming fungal iterative nonribosomal peptide synthetases", Nature communications, 8, pp. 15349. 210. Yu D., Xu F., Zi J., Wang S., Gage D., Zeng J., Zhan J. (2013), "Engineered production of fungal anticancer cyclooligomer depsipeptides in Saccharomyces cerevisiae", Metabolic engineering, 18, pp. 60-68. 211. Zaher A. M., Makboul M. A., Moharram A. M., Tekwani B. L., Calderón A. I. (2015), "A new enniatin antibiotic from the endophyte Fusarium tricinctum Corda", The Journal of antibiotics, 68(3), pp. 197-200. 212. Zala S. P., Patel K. P., Patel K. S., Parmar J. P., Sen D. J. (2012), "Laboratory techniques of purification and isolation", Int. J. Drug Dev. Res, 4(2), pp. 41-55. 213. Zhan J., Burns A. M., Liu M. X., Faeth S. H., Gunatilaka A. L. (2007), "Search for cell motility and angiogenesis inhibitors with potential anticancer activity: beauvericin and other constituents of two endophytic strains of Fusarium oxysporum", Journal of natural products, 70(2), pp. 227-232. 214. Zhang C., Jiang L., Wang Z. (2021), "Effect of coix seed on exopolysaccharide production of Cordyceps militaris in liquid culture", Arabian Journal of Chemistry, 14(3), pp. 102999. 215. Zhang H., Ruan C., Bai X., Zhang M., Zhu S., Jiang Y. (2016), "Isolation and identification of the antimicrobial agent beauvericin from the endophytic Fusarium oxysporum 5-19 with NMR and ESI-MS/MS", BioMed research international, 2016. 216. Zhang L., Fasoyin O. E., Molnár I., Xu Y. (2020), "Secondary metabolites from hypocrealean entomopathogenic fungi: novel bioactive compounds", Natural Product Reports. 217. Zhang L., Yan K., Zhang Y., Huang R., Bian J., Zheng C., Sun H., Chen Z., Sun N., An R. (2007), "High-throughput synergy screening identifies microbial metabolites as combination agents for the treatment of fungal infections", Proceedings of the National Academy of Sciences, 104(11), pp. 4606-4611. 218. Zhang X., Hu Q., Weng Q. (2019), "Secondary metabolites (SMs) of Isaria cicadae and Isaria tenuipes", RSC advances, 9(1), pp. 172-184. 219. Zhou Y.-M., Xie W., Ye J.-Q., Zhang T., Li D.-Y., Zhi J.-R., Zou X. (2020), "New potential strains for controlling Spodoptera frugiperda in China: Cordyceps cateniannulata and Metarhizium rileyi", BioControl, 65(6), pp. 663-672. 220. Zimmermann G. (2008), "The entomopathogenic fungi Isaria farinosa (formerly Paecilomyces farinosus) and the Isaria fumosorosea species complex (formerly Paecilomyces fumosoroseus): biology, ecology and use in biological control", Biocontrol science and technology, 18(9), pp. 865-901. 221. Zobel S., Kumpfmüller J., Süssmuth R. D., Schweder T. (2015), "Bacillus subtilis as heterologous host for the secretory production of the non-ribosomal cyclodepsipeptide enniatin", Applied microbiology and biotechnology, 99(2), pp. 681-691. III. Website 222. 223. https://vuonquocgiaxuanson.com.vn/bao-ton-da-dang-sinh-hoc PHỤ LỤC 1. Khả năng sinh trưởng của chủng nấm C. cateniannulata CPA14V trong 05 loại môi trường nghiên cứu Thời gian nuôi cấy (ngày) Khối lượng tế bào khô (g/l) PBG SBR MM CzD FDM 1 2,6d±0,082 2,11c±0,055 2,91e±0,014 0,89a±0,014 1,09b±0,041 2 6,75e±0,014 4,99d±0,068 3,96c±0,055 2,96a±0,042 3,57b±0,028 3 9,44e±0,069 6,65d±0,014 5,52b±0,014 4,4a±0,136 6,08c±0,068 4 9,42d±0,022 7,68c±0,122 6,87b±0,055 5,43a±0,028 7,5c±0,124 5 9,89e±0,069 8,8d±0,124 7,81c±0,082 5,82a±0,095 7,33b±0,082 6 10,23e±0,109 9,84d±0,097 7,23a±0,082 8,06b±0,069 8,59c±0,096 7 11,55d±0,041 11,81d±0,136 7,14a±0,125 8,71b±0,191 9,09c±0,095 8 11,85d±0,014 12,76e±0,027 7,16a±0,055 8,43b±0,178 9,11c±0,136 9 11,48d±0,014 14,07e±0,055 6,86a±0,055 8,27b±0,028 8,62c±0,095 10 11,47c±0,055 15,36d±0,151 6,66a±0,055 8,2b±0,028 8,01b±0,041 11 11,07d±0,021 15,43e±0,082 6,63a±0,109 7,03b±0,027 7,97c±0,036 12 10,88d±0,041 15,29e±0,357 6,62a±0,063 7,15b±0,095 8,17c±0,028 (So sánh giữa các công thức trong cùng một hàng, các chữ cái khác nhau (a, b, c, d, e) thể hiện sự sai khác có ý nghĩa thống kê ở mức α=0,05 với độ tin cậy 95%) 2. Khả năng sinh tổng hợp COD của chủng nấm C. cateniannulata CPA14V trong 05 loại môi trường nghiên cứu Thời gian nuôi cấy (ngày) Hàm lượng COD (mg/g) PBG SBR MM CzD FDM 1 0,438b±0,147 0,141a±0,012 0a±0,000 0a±0,000 0,035a±0,013 2 0,125ab±0,009 0,077a±0,003 0,101ab±0,002 0a±0,000 0,326b±0,214 3 0,204a±0,036 0,083a±0,013 0,35a±0,385 0,111a±0,008 0,07a±0,035 4 0,057a±0,023 0,047a±0,001 0,373a±0,413 0,11a±0,065 0,044a±0,032 5 0,382a±0,026 0,641a±0,021 0,121a±0,040 2,17b±0,844 0,13a±0,036 6 0,809a±0,265 4,306b±0,171 0,16a±0,088 6,452c±0,406 0,186a±0,004 7 0,785a±0,252 3,139b±0,444 0,24a±0,029 5,537c±0,307 0,116a±0,029 8 0,379a±0,042 2,51b±0,396 0,051a±0,037 5,334c±0,210 1,685b±0,530 9 0,382a±0,088 2,472b±0,970 0,21a±0,141 1,666ab±0,801 0,501a±0,279 10 0,055a±0,008 0,22a±0,011 0,202a±0,146 1,522b±0,225 0,201a±0,019 11 0,02a±0,008 0,197a±0,010 0,012a±0,005 2,385b±0,193 0,181a±0,004 12 0,006a±0,045 0,094a±0,069 0,104a±0,037 2,3b±0,644 0,477a±0,162 (So sánh giữa các công thức trong cùng một hàng, các chữ cái khác nhau (a, b, c) thể hiện sự sai khác có ý nghĩa thống kê ở mức α=0,05 với độ tin cậy 95%) 3. Ảnh hưởng của pH đến sự sinh trưởng và sinh tổng hợp COD của chủng C. cateniannulata CPA14V pH CDW (g/l) COD (mg/g) CDW x COD (mg/l) 3 0,067a ± 0,003 0a±0,000 0a±0,000 3,5 0,430ab ±0,08 0a±0,000 0a±0,000 4 0,604b ± 0,01 0a±0,000 0a±0,000 4,5 0,358ab± 0,041 0a±0,000 0a±0,000 5 0,412ab± 0,003 0a±0,000 0a±0,000 5,5 0,595b ± 0,016 0a±0,000 0a±0,000 6 1,258c ± 0,066 0a±0,000 0a±0,000 6,5 8,360d ± 0,107 4,963b ± 0,049 41,505b ± 0,116 7 8,270d ± 0,024 5,117b ± 0,130 42,318b ± 1,198 7,5 8,060d ± 0,144 5,783c ± 0,053 46,587c ± 0,429 8 8,200d ± 0,287 6,190d ± 0,090 50,774d ± 1,046 (So sánh các công thức trong cùng một cột, các chữ cái khác nhau (a,b,c) thể hiện sự sai khác có ý nghĩa thống kê ở mức α=0,05 với độ tin cậy 95%) 4. Ảnh hưởng của nguồn cacbon đến khả năng sinh trưởng và sinh tổng hợp COD của chủng C. cateniannulata CPA14V Nguồn cacbon CDW (g/l) COD (mg/g) CDW x COD (mg/l) Fructose 9,395d ± 0,273 6,003cd ± 0,039 56,400e ± 0,228 Sucrose 8,359c ± 0,232 5,630c ± 0,057 47,049d ± 0,829 Glucose 10,205e ± 0,082 5,797c ± 0,078 59,155e ± 0,328 Lactose 6,697b ± 0,109 6,375d ± 0,139 42,706c ± 1,623 Tinh bột tan 6,574b ± 0,191 5,631c ± 0,299 36,960b ± 2,997 Glactose 6,575b ± 0,069 5,118b ± 0,086 33,666b ± 0,922 Mannitol 2,463a ± 0,302 4,327a ± 0,021 10,665a ± 1,357 (So sánh giữa các công thức, trong cùng một cột, các chữ cái khác nhau (a,b,c) thể hiện sự sai khác có ý nghĩa thống kê ở mức α=0,05 với độ tin cậy 95%) 5. Ảnh hưởng của nguồn nitơ đến khả năng sinh trưởng và sinh tổng hợp COD của chủng C. cateniannulata CPA14V Nguồn Nitơ CDW (g/l) COD (mg/g) CDW x COD (mg/l) NaNO3 12,233f ± 0,249 4,967d ± 0,050 60,771fg ± 1,844 Cao nấm men 13,524g ± 0,313 4,863d ± 0,049 65,789g ± 2,186 Pepton 10,456d ± 0,204 5,156de ± 0,048 53,902de ± 0,619 Cao thịt 14,403h ± 0,055 4,189c ± 0,104 60,330fg ± 1,280 KNO3 11,404e ± 0,151 4,905d ± 0,163 55,961ef ± 2,598 NH4Cl 7,592a ± 0,069 2,817a ± 0,132 21,393a ± 1,189 NH4NO3 8,739b ± 0,136 4,323c ± 0,088 37,793b ± 1,336 (NH4)2SO4 9,457c ± 0,252 3,880b ± 0,099 36,717b ± 1,923 NH4HCO3 7,413a ± 0,237 6,330e ± 0,126 46,956c ± 2,446 MSG 8,683b ± 0,183 5,700f ± 0,159 49,524cd ± 2,405 (So sánh giữa các công thức trong cùng một cột, các chữ cái khác nhau (a,b,c) thể hiện sự sai khác có ý nghĩa thống kê ở mức α=0,05 với độ tin cậy 95%) 6. Ảnh hưởng của dung môi chiết đến hàm lượng CC1 Hàm lượng (%) Hệ dung môi n-hexane (H) dicholoro-methane (D) ethyl acetate (E) Ethanol (M) CC1 0,129±0,013 0,376±0,020 0,355±0,026 0,311±0,01 7. Ảnh hưởng của nhiệt độ đến hàm lượng CC1 Hàm lượng (%) Nhiệt độ 20oC 30oC 40oC 50oC 60oC CC1 0,292±0,01 0,308±0,016 0,326±0,024 0,376±0,012 0,378±0,02 8. Ảnh hưởng của thời gian siêu âm đến hàm lượng CC1 Hàm lượng (%) Thời gian 1h 2h 3h 4h CC1 0,281±0,023 0,370±0,015 0,377±0,02 0,376±0,02 9. Trình tự gen ITS, LSU và Rpb1 của các chủng nấm ký sinh côn trùng nghiên cứu LOCUS OK310721 521 bp DNA linear PLN 03-OCT-2021 DEFINITION Beauveria sp. strain CPA5 internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene and internal transcribed spacer 2, complete sequence; and large subunit ribosomal RNA gene, partial sequence. ACCESSION OK310721 VERSION OK310721.1 KEYWORDS . SOURCE Beauveria sp. ORGANISM Beauveria sp. Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae; Beauveria; unclassified Beauveria. REFERENCE 1 (bases 1 to 521) AUTHORS Lam,D.M., Van,N.T. and Viet,N.D. TITLE Direct Submission JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national university of education, xuanthuy, Hanoi 122000, Viet Nam COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..521 /organism="Beauveria sp." /mol_type="genomic DNA" /strain="CPA5" /db_xref="taxon:1891652" misc_RNA 521 /note="contains internal transcribed spacer 1, 5.8S ribosomal RNA, internal transcribed spacer 2, and large subunit ribosomal RNA" ORIGIN 1 cattaccgag ttttcaactc cctaaccctt ctgtgaacct acctatcgtt gcttcggcgg 61 actcgcccca gcccggacgc ggactggacc agcggcccgc cggggacctc aaactcttgt 121 attccagcat cttctgaata cgccgcaagg caaaacaaat gaatcaaaac tttcaacaac 181 ggatctcttg gctctggcat cgatgaagaa cgcagcgaaa tgcgataagt aatgtgaatt 241 gcagaatcca gtgaatcatc gaatctttga acgcacattg cgcccgccag cattctggcg 301 ggcatgcctg ttcgagcgtc atttcaaccc tcgacctccc ctgggggagg tcggcgttgg 361 ggaccggcag cacaccgccg gccctgaaat ggagtggcgg cccgtccgcg gcgacctctg 421 cgtagtaata cagctcgcac cggaaccccg acgcggccac gccgtaaaac acccaacttc 481 tgaacgttga cctcgaatca ggtaggacta cccgctgaac t // LOCUS OK310722 520 bp DNA linear PLN 03-OCT-2021 DEFINITION Beauveria sp. strain XS37 internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene and internal transcribed spacer 2, complete sequence; and large subunit ribosomal RNA gene, partial sequence. ACCESSION OK310722 VERSION OK310722.1 KEYWORDS . SOURCE Beauveria sp. ORGANISM Beauveria sp. Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae; Beauveria; unclassified Beauveria. REFERENCE 1 (bases 1 to 520) AUTHORS Lam,D.M., Van,N.T. and Viet,N.D. TITLE Direct Submission JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national university of education, xuanthuy, Hanoi 122000, Viet Nam COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..520 /organism="Beauveria sp." /mol_type="genomic DNA" /strain="XS37" /db_xref="taxon:1891652" misc_RNA 520 /note="contains internal transcribed spacer 1, 5.8S ribosomal RNA, internal transcribed spacer 2, and large subunit ribosomal RNA" ORIGIN 1 cattaccgag ttttcaactc cctaaccctt ctgtgaacct acctatcgtt gcttcggcgg 61 actcgcccca gcccggacgc ggactggacc agcggcccgc cggggacctc aaactcttgt 121 attccagcat cttctgaata cgccgcaagg cacaacaaat gaatcaaaac tttcaacaac 181 ggatctcttg gctctggcat cgatgaagaa cgcagcgaaa tgcgataagt aatgtgaatt 241 gcagaatcca gtgaatcatc gaatctttga acgcacattg cgcccgccag cattctggcg 301 ggcatgcctg ttcgagcgtc atttcaaccc tcgacctccc cttggggagg tcggcgttgg 361 ggaccggcag cacaccgccg gccctgaaat ggagtggcgg cccgtccgcg gcgacctctg 421 cgtagtaata cagctcgcac cggaaccccg acgcggccac gccgtaaaac acccaacttc 481 tgaacgttga cctcgaatca ggtaggacta cccgctgaac // LOCUS OK310723 521 bp DNA linear PLN 03-OCT-2021 DEFINITION Beauveria sp. strain XS38 internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene and internal transcribed spacer 2, complete sequence; and large subunit ribosomal RNA gene, partial sequence. ACCESSION OK310723 VERSION OK310723.1 KEYWORDS . SOURCE Beauveria sp. ORGANISM Beauveria sp. Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae; Beauveria; unclassified Beauveria. REFERENCE 1 (bases 1 to 521) AUTHORS Lam,D.M., Van,N.T. and Viet,N.D. TITLE Direct Submission JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national university of education, xuanthuy, Hanoi 122000, Viet Nam COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..521 /organism="Beauveria sp." /mol_type="genomic DNA" /strain="XS38" /db_xref="taxon:1891652" misc_RNA 521 /note="contains internal transcribed spacer 1, 5.8S ribosomal RNA, internal transcribed spacer 2, and large subunit ribosomal RNA" ORIGIN 1 cattaccgag ttttcaactc cctaaccctt ctgtgaacct acctatcgtt gcttcggcgg 61 actcgcccca gcccggacgc ggactggacc agcggcccgc cggggacctc aaactcttgt 121 attccagcat cttctgaata cgccgcaagg cacaacaaat gaatcaaaac tttcaacaac 181 ggatctcttg gctctggcat cgatgaagaa cgcagcgaaa tgcgataagt aatgtgaatt 241 gcagaatcca gtgaatcatc gaatctttga acgcacattg cgcccgccag cattctggcg 301 ggcatgcctg ttcgagcgtc atttcaaccc tcgacctccc cttggggagg tcggcgttgg 361 ggaccggcag cacaccgccg gccctgaaat ggagtggcgg cccgtccgcg gcgacctctg 421 cgtagtaata cagctcgcac cggaaccccg acgcggccac gccgtaaaac acccaacttc 481 tgaacgttga cctcgaatca ggtaggacta cccgctgaac t // LOCUS OK310724 521 bp DNA linear PLN 03-OCT-2021 DEFINITION Cordyceps sp. strain CPA13V internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene and internal transcribed spacer 2, complete sequence; and large subunit ribosomal RNA gene, partial sequence. ACCESSION OK310724 VERSION OK310724.1 KEYWORDS . SOURCE Cordyceps sp. ORGANISM Cordyceps sp. Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae; Cordyceps. REFERENCE 1 (bases 1 to 521) AUTHORS Lam,D.M., Van,N.T. and Viet,N.D. TITLE Direct Submission JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national university of education, xuanthuy, Hanoi 122000, Viet Nam COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..521 /organism="Cordyceps sp." /mol_type="genomic DNA" /strain="CPA13V" /db_xref="taxon:1755423" misc_RNA 521 /note="contains internal transcribed spacer 1, 5.8S ribosomal RNA, internal transcribed spacer 2, and large subunit ribosomal RNA" ORIGIN 1 cattaccgag ttttcaactc cccaaccctt ctgtgaacct acctatcgtt gcttcggcgg 61 actcgcccca gcccggacgc ggactggacc agcggcccgc cggggacctc aaactcttgt 121 attccagcat cttctgaata cgccgcaagg caaaacaaat gaatcaaaac tttcaacaac 181 ggatctcttg gctctggcat cgatgaagaa cgcagcgaaa tgcgataagt aatgtgaatt 241 gcagaatcca gtgaatcatc gaatctttga acgcacattg cgcccgccag cattctggcg 301 ggcatgcctg ttcgagcgtc atttcaaccc tcgacctccc cttggggagg tcggcgttgg 361 ggaccggcag cacaccgccg gccctgaaat ggagtggcgg cccgtccgcg gcgacctctg 421 cgtagtaata cagctcgcac cggaaccccg acgcggccac gccgtaaaac acccaacttc 481 tgaacgttga cctcgaatca ggtaggacta cccgctgaac t // LOCUS OK310725 586 bp DNA linear PLN 03-OCT-2021 DEFINITION Cordyceps sp. strain CPA31 small subunit ribosomal RNA gene, partial sequence; internal transcribed spacer 1, 5.8S ribosomal RNA gene, and internal transcribed spacer 2, complete sequence; and large subunit ribosomal RNA gene, partial sequence. ACCESSION OK310725 VERSION OK310725.1 KEYWORDS . SOURCE Cordyceps sp. ORGANISM Cordyceps sp. Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae; Cordyceps. REFERENCE 1 (bases 1 to 586) AUTHORS Lam,D.M., Van,N.T. and Viet,N.D. TITLE Direct Submission JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national university of education, xuanthuy, Hanoi 122000, Viet Nam COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..586 /organism="Cordyceps sp." /mol_type="genomic DNA" /strain="CPA31" /db_xref="taxon:1755423" misc_RNA 586 /note="contains small subunit ribosomal RNA, internal transcribed spacer 1, 5.8S ribosomal RNA, internal transcribed spacer 2, and large subunit ribosomal RNA" ORIGIN 1 aacaaggttt ccgttggtga accagcggag ggatcattac cgagttttca actccctaac 61 cctttgtgaa catacctatc gttgcttcgg cggactcgcc ccggcgtccg gacggccttg 121 cgccgcccgc ggcccggacc caggcggccg ccggagaacc ttaaactctg tttccatcag 181 tctctctgaa tccgccgcaa ggcaaaacaa atgaatcaaa actttcaaca acggatctct 241 tggttctggc atcgatgaag aacgcagcga aatgcgataa gtaatgtgaa ttgcagaatt 301 cagtgaatca tcgaatcttt gaacgcacat tgcgcccgcc agcattctgg cgggcatgcc 361 tgttcgagcg tcatttcaac cctcgacacc ccttcggggg agtcggcgtt ggggaccggc 421 agcacaccgc cggccccgaa atacagtggc ggcccgtccg cggcgacctc tgcgtagtac 481 tccaacgcgc accgggaacc cgacgcggcc acgccgttaa ccaccccact tctgaacgtt 541 gacctcggat caggtaggac tacccgctga acttaagcat atcaat // LOCUS OK310726 586 bp DNA linear PLN 03-OCT-2021 DEFINITION Cordyceps sp. strain XS67 small subunit ribosomal RNA gene, partial sequence; internal transcribed spacer 1, 5.8S ribosomal RNA gene, and internal transcribed spacer 2, complete sequence; and large subunit ribosomal RNA gene, partial sequence. ACCESSION OK310726 VERSION OK310726.1 KEYWORDS . SOURCE Cordyceps sp. ORGANISM Cordyceps sp. Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae; Cordyceps. REFERENCE 1 (bases 1 to 586) AUTHORS Lam,D.M., Van,N.T. and Viet,N.D. TITLE Direct Submission JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national university of education, xuanthuy, Hanoi 122000, Viet Nam COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..586 /organism="Cordyceps sp." /mol_type="genomic DNA" /strain="XS67" /db_xref="taxon:1755423" misc_RNA 586 /note="contains small subunit ribosomal RNA, internal transcribed spacer 1, 5.8S ribosomal RNA, internal transcribed spacer 2, and large subunit ribosomal RNA" ORIGIN 1 gggaagtaaa aaatcgtaac aaggtctccg ttggtgaacc agcggaggga tcattaccag 61 agttttacaa ctcccaaccc ttctgtgaac ctacccatcg ttgcttcggc ggactcgccc 121 cagcgtccgg acggccccgc gccggcccgc gacccggacc caggcggccg ccggagacca 181 cgcaaccctg tatccatcag tctctctgaa tccgccgcaa ggcaacacaa atgaatcaaa 241 actttcaaca acggatctct tggttctggc atcgatgaag aacgcagcga aatgcgatac 301 gtaatgtgaa aggcagaatt ccgcgaatca tcgaatcttt gaacgcacat tgcgcccgcc 361 agcattctgg cgggcatgcc tgttcgagcg tcatttcaac cctcgacgtc ccccgggacg 421 tcggccttgg ggaccggcag caccccgccg gccctgaaat ggagtggcgg cccgtccgcg 481 gcgacctctg cgcagtacaa ccactcgcac cgggaacccg acgcggcccg ccgtgaaacc 541 cccaacctct gaacgctgac ctcggatcag gtagactccc ccgggg // LOCUS OK310727 578 bp DNA linear PLN 03-OCT-2021 DEFINITION Isaria sp. strain CPA40 small subunit ribosomal RNA gene, partial sequence; internal transcribed spacer 1, 5.8S ribosomal RNA gene, and internal transcribed spacer 2, complete sequence; and large subunit ribosomal RNA gene, partial sequence. ACCESSION OK310727 VERSION OK310727.1 KEYWORDS . SOURCE Isaria sp. ORGANISM Isaria sp. Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae; Isaria; unclassified Isaria. REFERENCE 1 (bases 1 to 578) AUTHORS Lam,D.M., Van,N.T. and Viet,N.D. TITLE Direct Submission JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national university of education, xuanthuy, Hanoi 122000, Viet Nam COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..578 /organism="Isaria sp." /mol_type="genomic DNA" /strain="CPA40" /db_xref="taxon:1906752" misc_RNA 578 /note="contains small subunit ribosomal RNA, internal transcribed spacer 1, 5.8S ribosomal RNA, internal transcribed spacer 2, and large subunit ribosomal RNA" ORIGIN 1 atcaggtctc gttggtgacc agcggaggga tcattaccag aggttacaac tcccaaccct 61 tctgtgaacc tacccatagt tgcttcggcg gacccgcccc agcgtccgga cggcccagcg 121 ccggcccgcg acctggaccc aggcggccgc cggggaccac gcaaccctgt atctgtcagc 181 ctctctgaat ccgccgcaag gcaacacaaa cgaatcaaaa ctttcaacaa cggatctctt 241 ggttctggca tcgatgaaga acgcagcgaa atgcgatacg taatgtgaat tgcagaattc 301 cgtgaatcat cgaatctttg aacgcacatt gcgcccgcca gcattctggc gggcatgcct 361 gttcgagcgt caattcaaac ctcgacgtcc cccgggacgt cggccttggg gaccggcagc 421 accccgccgg ccctgaaatg gagtggcggc ccgtccgcgg cgacctctgc gcagtacaag 481 cactcgcacc gggaacccga cgcggcccgc cgtgaaaccc ccaacctctg aacgttgacc 541 tcggatcagg taggactacc cgctgaactt aagcatat // LOCUS OK310728 584 bp DNA linear PLN 03-OCT-2021 DEFINITION Ophiocordyceps sp. strain CPA1 small subunit ribosomal RNA gene, partial sequence; internal transcribed spacer 1, 5.8S ribosomal RNA gene, and internal transcribed spacer 2, complete sequence; and large subunit ribosomal RNA gene, partial sequence. ACCESSION OK310728 VERSION OK310728.1 KEYWORDS . SOURCE Ophiocordyceps sp. ORGANISM Ophiocordyceps sp. Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Ophiocordycipitaceae; Ophiocordyceps. REFERENCE 1 (bases 1 to 584) AUTHORS Lam,D.M., Van,N.T. and Viet,N.D. TITLE Direct Submission JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national university of education, xuanthuy, Hanoi 122000, Viet Nam COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..584 /organism="Ophiocordyceps sp." /mol_type="genomic DNA" /strain="CPA1" /db_xref="taxon:1912256" misc_RNA 584 /note="contains small subunit ribosomal RNA, internal transcribed spacer 1, 5.8S ribosomal RNA, internal transcribed spacer 2, and large subunit ribosomal RNA" ORIGIN 1 cgtttagtct cgttggtgac cagcggagga atcattacca gagttttaca actcccaacc 61 cttctgtgaa cctacccata gttgcttcgg cggacccgcc ccagcgtccg gacggcccag 121 cgccggcccg cgacctggac ccaggcggcc gccggggacc acgcaaccct gtatctgtca 181 gcctctctga atccgccgca aggcaacaca aacgaatcaa aactttcaac aacggatctc 241 ttggttctgg catcgatgaa gaacgcagcg aaatgcgata cgtaatgtga attgcagaat 301 tccgtgaatc atcgaatctt tgaacgcaca ttgcgcccgc cagcattctg gcgggcatgc 361 ctgttcgagc gtcatttcaa ccctcgacgt cccccgggac gtcggccttg gggaccggca 421 gcaccccgcc ggccctgaaa tggagtggcg gcccgtccgc ggcgacctct gcgcagtaca 481 agcactcgca ccgggaaccc gacgcggccg gccgtgaaac ccccaacctc tgaacgttga 541 cctcggatca ggtaggacta cccgctgaac ttaagcatat taaa // LOCUS OK310729 563 bp DNA linear PLN 03-OCT-2021 DEFINITION Purpureocillium sp. strain XS77 internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene and internal transcribed spacer 2, complete sequence; and large subunit ribosomal RNA gene, partial sequence. ACCESSION OK310729 VERSION OK310729.1 KEYWORDS . SOURCE Purpureocillium sp. ORGANISM Purpureocillium sp. Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Ophiocordycipitaceae; Purpureocillium; unclassified Purpureocillium. REFERENCE 1 (bases 1 to 563) AUTHORS Lam,D.M., Van,N.T. and Viet,N.D. TITLE Direct Submission JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national university of education, xuanthuy, Hanoi 122000, Viet Nam COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..563 /organism="Purpureocillium sp." /mol_type="genomic DNA" /strain="XS77" /db_xref="taxon:1926681" misc_RNA 563 /note="contains internal transcribed spacer 1, 5.8S ribosomal RNA, internal transcribed spacer 2, and large subunit ribosomal RNA" ORIGIN 1 cagcggaggg atcattaccg agttatacaa ctcccaaacc cactgtgaac cttacctcag 61 ttgcctcggc gggaacgccc cggccgcctg cccccgcgcc ggcgccggac ccaggcgccc 121 gccgcaggga ccccaaactc tcttgcatta cgcccagcgg gcggaatttc ttctctgagt 181 tgcacaagca aaaacaaatg aatcaaaact ttcaacaacg gatctcttgg ttctggcatc 241 gatgaagaac gcagcgaaat gcgataagta atgtgaattg cagaattcag tgaatcatcg 301 aatctttgaa ggcacattgc gcccgccagc attctggcgg gcatgcctgt tcgagcgtca 361 tttcaaccct cgagcccccc ggggggcctc ggtgttgggg gacggcacac cagccgcccc 421 cgaaatgcag tggcgacccc gccgcagcct cccctgcgta gtagcacaca cctcgcaccg 481 gagcgcggag gcggtcacgc cgtaaaacgc ccaactttct tagagttgac ctcggatcag 541 gtaggaatac ccgctgaact taa // LOCUS MK634637 554 bp DNA linear PLN 26-AUG-2021 DEFINITION Cordyceps sp. isolate CPA14V small subunit ribosomal RNA gene, partial sequence; internal transcribed spacer 1 and 5.8S ribosomal RNA gene, complete sequence; and internal transcribed spacer 2, partial sequence. ACCESSION MK634637 VERSION MK634637.2 SOURCE Cordyceps sp. ORGANISM Cordyceps sp. Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae; Cordyceps. REFERENCE 1 (bases 1 to 554) AUTHORS Lam,D.M. and Van,N.T.T. TITLE Direct Submission JOURNAL Submitted (15-MAR-2019) faculty of biology, 1991, 29, Ha noi 122000, Viet Nam COMMENT On Aug 26, 2021 this sequence version replaced MK634637.1. ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..554 /organism="Cordyceps sp." /mol_type="genomic DNA" /isolate="CPA14V" /db_xref="taxon:1755423" misc_RNA 554 /note="contains small subunit ribosomal RNA, internal transcribed spacer 1, 5.8S ribosomal RNA, and internal transcribed spacer 2" ORIGIN 1 aacaaggtct ccgttggtga accagcggag ggatcattac cagagttttt acaactccca 61 acccttctgt gaacctacct atcgttgctt cggcggactc gccccagcgt ccggacggcc 121 ccgcgccggc ccgcgacctg gacccaggcg gccgccggag gccccacaac cctgtatcca 181 tcagtctctc tgaatccgcc gcaaggcaaa caaatgaatc aaaactttca acaacggatc 241 tcttggttct ggcatcgatg aagaacgcag cgaaacgcga taagtaatgt gaattgcaga 301 atttagtgaa tcatcgaatc tttgaacgca cattgcgccc gccagcattc tggcgggcat 361 gcctgttcga gcgtcatttc aaccctcgac gtcccctggg gacgtcggcc ttggggaccg 421 gcagcacacc gccggccctg aaatcgagtg gcggcccgtc cgcggcgacc tctgcgcagt 481 actccagctc gcaccgggac cccgacgcgg ccacgccgta aaacacccaa ctctgaacgt 541 tgacctcgga tcag // LOCUS MZ923986 852 bp DNA linear PLN 26-AUG-2021 DEFINITION Cordyceps sp. isolate CPA14V large subunit ribosomal RNA gene, partial sequence. ACCESSION MZ923986 VERSION MZ923986 SOURCE Cordyceps sp. ORGANISM Cordyceps sp. Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae; Cordyceps. REFERENCE 1 (bases 1 to 852) AUTHORS Duong,L.M. and Nguyen,V.T. TITLE Direct Submission JOURNAL Submitted (26-AUG-2021) faculty of biology, hanoi national university of education, xuanthuy, Hanoi 122000, Viet Nam COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..852 /organism="Cordyceps sp." /mol_type="genomic DNA" /isolate="CPA14V" /db_xref="taxon:1755423" rRNA 852 /product="large subunit ribosomal RNA" ORIGIN 1 gggattgccc cagtaacggc gagtgaagcg gcaacagctc aaatttgaaa tctggccccc 61 gggtccgagt tgtaatttgc agaggatgct ttgggcgagg tgccttccga gttccctgga 121 acgggacgcc acagagggtg agagccccgt ctggtcggac accgagcccg tgtaaagctc 181 cttcgacgag tcgagtagtt tgggaatgct gctcaaaatg ggaggtatat gtcttctaaa 241 gctaaatatt ggccagagac cgatagcgca caagtagagt gatcgaaaga tgaaaagcac 301 tttgaaaaga gggttaaaaa gtacgtgaaa ttgttgaaag ggaagcgcct atgaccagac 361 ttgggcccgg tgaatcatcc agcgttctcg ctggtgcact ttgccgggca caggccagca 421 tcagtttggc gcgggggaca aaggcttcgg gaatgtggct ccctcgggag tgttatagcc 481 cgctgcgtaa taccctgcgc cggactgagg tacgcgcatc gcaaggatgc tggcgtaatg 541 gtcatcagcg acccgtcttg aaacacggac caaggagtcg tcttcgtatg cgagtgttcg 601 ggtgtcaaac ccctacgcgg aatgaaagtg aacgcaggtg agagcttcgg cgcatcatcg 661 accgatcctg atgttctcgg atggatttga gtaagagcat acggggccgg acccgaaaga 721 aggtgaacta tgcctgtata gggtgaagcc agaggaaact ctggtggagg ctcgcagcgg 781 ttctgacgtg cgaatcgatc gtcaaatatg ggcatggggg cgaaagacta atcgaacctt 841 ctagtagctg gt // LOCUS Seq1 570 bp RNA linear PLN 27-AUG-2021 DEFINITION Cordyceps sp. CPA14V. ACCESSION Seq1 VERSION SOURCE Cordyceps sp. ORGANISM Cordyceps sp. Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae; Cordyceps. REFERENCE 1 (bases 1 to 570) AUTHORS Duong,L.M. and Nguyen,V.T.T. TITLE Direct Submission JOURNAL Submitted (27-AUG-2021) biology, Hanoi national university of education, Xuan thuy, Hanoi, Hanoi 122000, Vietnam COMMENT Bankit Comment: ALT EMAIL:tranloan2910@gmail.com Bankit Comment: TOTAL # OF SEQS:1 ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..570 /organism="Cordyceps sp." /mol_type="other RNA" /db_xref="taxon:1755423" gene 1..>570 /gene="RPB1" CDS 1..>570 /gene="RPB1" /note="ARN polymerase II large subunit" /codon_start=1 /product="ARN polymerase II" /translation="DPEFVAAIRTRDPKLRFKRVWAVCKKKRKCENEDRQDKNKDEEF APGAKNVVLEGHGGCGNMQPQVRQAALQLKAAFEVTSEEGPKRKETVNISAEMAHGIL RRISERDLHNMGLNSDYARPEWMIITVLPVPPPPVRPSISMDGTGTGMRNEDDLTYKL GDIIRANGNVKQAIREGSPQHIARDFEELL" BASE COUNT 146 a 147 c 158 g 119 t ORIGIN 1 gatcccgaat tcgttgcagc tattcgtact agagatccga aacttcgatt caagcgcgtc 61 tgggccgtgt gcaagaagaa gcgcaagtgc gagaatgagg accggcaaga caagaacaag 121 gatgaggagt ttgcaccggg cgctaagaac gttgttctcg aaggacacgg cggatgtggc 181 aacatgcagc cgcaagtgag acaagctgcg ctgcaactca aggctgcttt cgaagtcacc 241 tcggaggaag gccccaagag aaaggagacc gtcaatatca gcgccgaaat ggctcatggt 301 atccttcgtc gcatctctga gcgcgatctg cacaatatgg gtctcaactc ggactatgcc 361 cgtcccgagt ggatgatcat caccgttctg cctgtacctc ctcctcctgt gcgtcctagt 421 atttccatgg atggtactgg tactggcatg agaaacgaag acgatttgac ctacaagctt 481 ggcgacatta tccgcgccaa cggcaatgtc aagcaggcaa ttcgtgaagg atcaccgcaa 541 cacattgcgc gcgattttga ggagcttctg 10. Hoạt tính sinh học của của các cao chiết tổng, phân đoạn và chất sạch COD của chủng nấm C. cateniannulata CPA14V 11. Cấu trúc hóa học của chất sạch CC1