1.1. Từ 24 mẫu ký chủ thuộc các bộ côn trùng Blattodea, Hemiptera, Coleoptera, Hymenoptera, Lepidoptera thu thập được ở Khu bảo tồn thiên nhiên Copia và Vườn Quốc gia Xuân Sơn, chúng tôi đã tiến hành phân lập được 24 chủng nấm. Các chủng nấm đã phân lập được đa dạng phong phú được phân loại vào 6 chi bao gồm chi Aschersonia, Purpureocillium, Beauveria, Cordyceps, Isaria, và Ophiocordyceps.
1.2. Nghiên cứu sàng lọc khả năng sinh tổng hợp COD của các chủng nấm ký sinh côn trùng ở khu vực nghiên cứu xác định được 19/24 chủng có khả năng sinh tổng hợp COD. Trong số đó chủng nấm CPA14V phân lập từ mẫu nấm ký sinh trên bộ côn trùng Blattodea có khả năng sinh tổng hợp COD tốt nhất để tiến hành nghiên cứu sâu hơn.
1.3. Nghiên cứu một số đặc điểm hình thái và định loại chủng nấm đã tuyển chọn bằng phương pháp sinh học phân tử xác định được chủng nấm CPA14V loài Cordyceps cateniannulata, chi Cordyceps, họ Cordycipitaceae. Đây là lần đầu tiên ghi nhận sự có mặt của loài Cordyceps cateniannulata tại Việt Nam.
1.4. Môi trường Czapek-Dox (CzD) với độ pH môi trường 8, nguồn cacbon là glucose, nguồn nitơ là cao nấm men, rất phù hợp cho sinh trưởng và sinh tổng hợp COD của chủng nấm C. cateniannulata CPA14V. Khi sử dụng môi trường này kết hợp với nuôi lắc 150 vòng/phút trong thời gian 6 ngày ở nhiệt độ 25oC chúng tôi thu được kết quả 65,789 ± 2,186 mg/l COD. Tương đương với các nghiên cứu của các chủng nấm đã được công bố trên thế giới.
1.5. Đã xác định được điều kiện tách chiết và thu hồi COD từ sinh khối chủng nấm C. cateniannulata CPA14V. Sử dụng dung môi chiết dichloromethane, trong điều kiện nhiệt độ 40-50oC siêu âm trong 2h và quy trình tách chiết đã đề xuất thu được COD sạch 98,1% với hiệu suất thu hồi đạt 0,37% lượng sinh khối khô. Đã xác định được cấu trúc hóa học của COD thu được từ chủng C. cateniannulata CPA14V. COD có ba nhóm N-MePhe và ba nhóm Hiv, có tên gọi là beauvericin.
1.6. Beauvericin thu được từ chủng C. cateniannulata CPA14V thể hiện hoạt tính sinh học tốt. Có khả năng gây độc dòng tế bào ung thư gan Hep-G2 (giá trị IC50=19,17 µg/mL), ung thư tuyến tiền liệt (PC-3) (giá trị IC50= 23,52 µg/mL), thể hiện hoạt tính kháng vi sinh vật kiểm định tốt nhất với tất cả các chủng vi khuẩn và nấm thử nghiệm bao gồm chủng E. coli, P. aeruginosa, B. subtilis, S. cerevisiae, S. aureus, A. niger, F. oxysporum, và C. albicans với giá trị MIC= 100- 200µg/ml.
218 trang |
Chia sẻ: huydang97 | Ngày: 27/12/2022 | Lượt xem: 293 | Lượt tải: 0
Bạn đang xem trước 20 trang tài liệu Luận án Nghiên cứu đa dạng và sinh tổng hợp Cyclooligomer Depsipeptide của nấm ký sinh côn trùng tại khu bảo tồn thiên nhiên Copia và vườn quốc gia Xuân Sơn, để xem tài liệu hoàn chỉnh bạn click vào nút DOWNLOAD ở trên
n and studies on precursor-directed biosynthesis", Tetrahedron, 59(7), pp. 1015-1020.
125. Nilanonta C., Isaka M., Kittakoop P., Palittapongarnpim P., Kamchonwongpaisan S., Pittayakhajonwut D., Tanticharoen M., Thebtaranonth Y. (2000), "Antimycobacterial and antiplasmodial cyclodepsipeptides from the insect pathogenic fungus Paecilomyces tenuipes BCC 1614", Planta medica, 66(08), pp. 756-758.
126. Nilanonta C., Isaka M., Kittakoop P., Trakulnaleamsai S., Tanticharoen M., Thebtaranonth Y. (2002), "Precursor-directed biosynthesis of beauvericin analogs by the insect pathogenic fungus Paecilomyces tenuipes BCC 1614", Tetrahedron, 58(17), pp. 3355-3360.
127. Niu X., Xie W., Zhang J., Hu Q. (2019), "Biodiversity of entomopathogenic fungi in the soils of South China", Microorganisms, 7(9), pp. 311.
128. Ohshiro T., Matsuda D., Kazuhiro T., Uchida R., Nonaka K., Masuma R., Tomoda H. (2012), "New verticilides, inhibitors of acyl-CoA: cholesterol acyltransferase, produced by Verticillium sp. FKI-2679", The Journal of antibiotics, 65(5), pp. 255.
129. Ohyama M., Okada Y., Takahashi M., Sakanaka O., Matsumoto M., Atsumi K. (2011), "Structure-activity relationship of anthelmintic cyclooctadepsipeptides", Bioscience, biotechnology, and biochemistry, 75(7), pp. 1354-1363.
130. Olatunji O. J., Tang J., Tola A., Auberon F., Oluwaniyi O., Ouyang Z. (2018), "The genus Cordyceps: An extensive review of its traditional uses, phytochemistry and pharmacology", Fitoterapia, 129, pp. 293-316.
131. Olleik H., Nicoletti C., Lafond M., Courvoisier-Dezord E., Xue P., Hijazi A., Baydoun E., Perrier J., Maresca M. (2019), "Comparative Structure–Activity Analysis of the Antimicrobial Activity, Cytotoxicity, and Mechanism of Action of the Fungal Cyclohexadepsipeptides Enniatins and Beauvericin", Toxins, 11(9), pp. 514.
132. Park S. J., Hyun S.-H., Suh H. W., Lee S.-Y., Sung G.-H., Kim S. H., Choi H.-K. (2013), "Biochemical characterization of cultivated Cordyceps bassiana mycelia and fruiting bodies by 1 H nuclear magnetic resonance spectroscopy", Metabolomics, 9(1), pp. 236-246.
133. Paszkiewicz M., Tyma M., Ligeza-Zuber M., Włóka E., Bogus M., Stepnowski P. (2017), "Mycotoxin production by entomopathogenic fungus Conidiobolus coronatus", Int. J. Environ. Agric. Res, 3, pp. 33-40.
134. Pedras M. S. C., Zaharia L. I., Ward D. E. (2002), "The destruxins: synthesis, biosynthesis, biotransformation, and biological activity", Phytochemistry, 59(6), pp. 579-596.
135. Peeters H., Zocher R., Madry N., Kleinkauf H. (1983), "Incorporation of radioactive precursors into beauvericin produced by Paecilomyces fumosoroseus", Phytochemistry, 22(8), pp. 1719-1720.
136. Permadi M., Samosir B., Siregar D., Wayni M. (2020), Physiology Characterization of Entomopathogenic Fungi Beauveria bassiana and Metarhizium anisopliae on Different Carbohydrate Sources, Journal of Physics: Conference Series, IOP Publishing, pp. 072007.
137. Pettit R. K., Pettit G. R., Xu J. P., Weber C. A., Richert L. A. (2010), "Isolation of human cancer cell growth inhibitory, antimicrobial lateritin from a mixed fungal culture", Planta medica, 76(05), pp. 500-501.
138. Pohanka A., Capieau K., Broberg A., Stenlid J., Stenström E., Kenne L. (2004), "Enniatins of Fusarium sp. Strain F31 and Their Inhibition of Botrytis c inerea Spore Germination", Journal of natural products, 67(5), pp. 851-857.
139. Rachmawati R., Kinoshita H., Nihira T. (2017), "Production of Insect Toxin Beauvericin from Entomopathogenic Fungi Cordyceps militaris by Heterologous Expression of Global Regulator", Agrivita, Journal of Agricultural Science, 40(1), pp. 177-184.
140. Ramakuwela T., Hatting J., Bock C., Vega F. E., Wells L., Mbata G. N., Shapiro-Ilan D. (2020), "Establishment of Beauveria bassiana as a fungal endophyte in pecan (Carya illinoinensis) seedlings and its virulence against pecan insect pests", Biological Control, 140, pp. 104102.
141. Rangel M., José Correia de Santana C., Pinheiro A., dos Anjos L., Barth T., Rodrigues Pires Júnior O., Fontes W., S Castro M. (2017), "Marine depsipeptides as promising pharmacotherapeutic agents", Current Protein and Peptide Science, 18(1), pp. 72-91.
142. Rehner S. A., Samuels G. J. (1994), "Taxonomy and phylogeny of Gliocladium analysed from nuclear large subunit ribosomal DNA sequences", Mycological Research, 98(6), pp. 625-634.
143. Ríos-Moreno A., Garrido-Jurado I., Resquín-Romero G., Arroyo-Manzanares N., Arce L., Quesada-Moraga E. (2016), "Destruxin A production by Metarhizium brunneum strains during transient endophytic colonisation of Solanum tuberosum", Biocontrol science and technology, 26(11), pp. 1574-1585.
144. Rippke F., Berardesca E., Weber T. M. (2018), "pH and Microbial Infections", Current problems in dermatology, 54, pp. 87-94.
145. Roskov Y., Ower G., Orrell T., Nicolson D., Bailly N., Kirk P.M., Bourgoin T., DeWalt R.E., Decock W., Nieukerken E. van, Zarucchi J., Penev L. e. (2019), Species 2000 & ITIS Catalogue of Life, 2019 Annual Checklist, chủ biên, Digital resource at www.catalogueoflife.org/annual-checklist/2019. Species 2000: Naturalis, Leiden, the Netherlands. ISSN 2405-884X.
146. Rózsa M., Apahidean M. (2020), "Influence of temperature and pH level on mycelial growth in liquid cultures of Cordyceps militaris mushroom", Current Trends in Natural Sciences, 9(18), pp. 42-46.
147. Sangdee A., Sangdee K. (2013), "Isolation, identification, culture and production of adenosine and cordycepin from Cicada larva infected with entomopathogenic fungi in Thailand", African Journal of Microbiology Research, 7(2), pp. 137-146.
148. Santi L., Coutinho-Rodrigues C. J., Berger M., Klein L. A., De Souza E. M., Rosa R. L., Guimarães J. A., Yates J. R., Perinotto W. M., Bittencourt V. R. (2019), "Secretomic analysis of Beauveria bassiana related to cattle tick, Rhipicephalus microplus, infection", Folia microbiologica, 64(3), pp. 361-372.
149. Santos D. S., Diniz A. C., Tiago A. G., Vieira P., Oliveira D., Tinti N. (2020), "Entomopathogenic Fusarium species: a review of their potential for the biological control of insects, implications and prospects", Fungal Biology Reviews, 34(1), pp. 41-57.
150. Sasaki T., Takagi M., Yaguchi T., Miyadoh S., Okada T., Koyama M. (1992), "A new anthelmintic cyclodepsipeptide, PF1022A", The Journal of antibiotics, 45(5), pp. 692-697.
151. Sato T., Ishiyama D., Honda R., Senda H., Konno H., Tokumasu S., Kanazawa S. (2000), "Glomosporin, a Novel Antifungal Cyclic Depsipeptide from Glomopora sp", The Journal of antibiotics, 53(6), pp. 597-602.
152. Schoch C. L., Seifert K. A., Huhndorf S., Robert V., Spouge J. L., Levesque C. A., Chen W., Consortium F. B. (2012), "Nuclear ribosomal internal transcribed spacer (ITS) region as a universal DNA barcode marker for Fungi", Proceedings of the National Academy of Sciences, 109(16), pp. 6241-6246.
153. Sebastià N., Meca G., Soriano J. M., Mañes J. (2011), "Antibacterial effects of enniatins J1 and J3 on pathogenic and lactic acid bacteria", Food and chemical toxicology, 49(10), pp. 2710-2717.
154. Shimazu M. (2001), "Paecilomyces cateniannulatus Liang, a commonly found, but an unrecorded entomogenous fungus in Japan", Applied Entomology and Zoology, 36(3), pp. 283-288.
155. Shin C. G., An D. G., Song H. H., Lee C. (2009), "Beauvericin and enniatins H, I and MK1688 are new potent inhibitors of human immunodeficiency virus type-1 integrase", The Journal of antibiotics, 62(12), pp. 687.
156. Shiono Y., Tsuchinari M., Shimanuki K., Miyajima T., Murayama T., Koseki T., Laatsch H., Funakoshi T., Takanami K., Suzuki K. (2007), "Fusaristatins A and B, two new cyclic lipopeptides from an endophytic Fusarium sp", The Journal of antibiotics, 60(5), pp. 309.
157. Shrestha B., Tanaka E., Hyun M. W., Han J.-G., Kim C. S., Jo J. W., Han S.-K., Oh J., Sung G.-H. (2016), "Coleopteran and lepidopteran hosts of the entomopathogenic genus Cordyceps sensu lato", Journal of Mycology, 2016.
158. Sieber S. A., Marahiel M. A. (2005), "Molecular mechanisms underlying nonribosomal peptide synthesis: approaches to new antibiotics", Chemical reviews, 105(2), pp. 715-738.
159. Sikder M. M., Mallik M. R. I., Alam N. (2019), "Identification and in vitro Growth Characteristics of Entomopathogenic fungus-Aschersonia sp. in Bangladesh".
160. Sivanathan S., Scherkenbeck J. (2014), "Cyclodepsipeptides: A rich source of biologically active compounds for drug research", Molecules, 19(8), pp. 12368-12420.
161. Smedsgaard J. (1997), "Micro-scale extraction procedure for standardized screening of fungal metabolite production in cultures", Journal of Chromatography A, 760(2), pp. 264-270.
162. Song H. H., Lee H. S., Jeong J. H., Park H. S., Lee C. (2008), "Diversity in beauvericin and enniatins H, I, and MK1688 by Fusarium oxysporum isolated from potato", International journal of food microbiology, 122(3), pp. 296-301.
163. Sood S., Sandhu S., Mukherjee T. (2017), "Pharmacological and Therapeutic Potential of Beauvericin: A Short Review", J Proteomics Bioinform, 10(1), pp. 18-23.
164. Steiniger C., Hoffmann S., Mainz A., Kaiser M., Voigt K., Meyer V., Süssmuth R. D. (2017), "Harnessing fungal nonribosomal cyclodepsipeptide synthetases for mechanistic insights and tailored engineering", Chemical science, 8(11), pp. 7834-7843.
165. Sung G. H., Hywel-Jones N. L., Sung J.-M., Luangsa-Ard J. J., Shrestha B., Spatafora J. W. (2007), "Phylogenetic classification of Cordyceps and the clavicipitaceous fungi", Studies in mycology, 57, pp. 5-59.
166. Sung G. H., Sung J. M., Hywel-Jones N. L., Spatafora J. W. (2007), "A multi-gene phylogeny of Clavicipitaceae (Ascomycota, Fungi): identification of localized incongruence using a combinational bootstrap approach", Molecular phylogenetics and evolution, 44(3), pp. 1204-1223.
167. Supothina S., Isaka M., Kirtikara K., Tanticharoen M., Thebtaranonth Y. (2004), "Enniatin production by the entomopathogenic fungus Verticillium hemipterigenum BCC 1449", The Journal of antibiotics, 57(11), pp. 732-738.
168. Supothina S., Srisanoh U., Nithithanasilp S., Tasanathai K., Luangsa-Ard J. J., Li C.-R., Isaka M. (2011), "Beauvericin production by the Lepidoptera pathogenic fungus Isaria tenuipes: Analysis of natural specimens, synnemata from cultivation, and mycelia from liquid-media fermentation", Natural products and bioprospecting, 1(3), pp. 112-115.
169. Süssmuth R., Müller J., Von Döhren H., Molnár I. (2011), "Fungal cyclooligomer depsipeptides: from classical biochemistry to combinatorial biosynthesis", Natural product reports, 28(1), pp. 99-124.
170. Süssmuth R. D., Mainz A. (2017), "Nonribosomal peptide synthesis - principles and prospects", Angewandte Chemie International Edition, 56(14), pp. 3770-3821.
171. Sy-Cordero A. A., Pearce C. J., Oberlies N. H. (2012), "Revisiting the enniatins: a review of their isolation, biosynthesis, structure determination and biological activities", The Journal of antibiotics, 65(11), pp. 541.
172. Hung L. T., Hanh V. T., Phuong L. T. B. , Phong T. T. , Van T. T. H., Sivichai S. (2010), "Entomopathogenic fungi at Cat Tien National Park: The potential materials for biological application", Scientific Conference celebrates 35 years of Vietnam Academy of Science and Technology.
173. Taevernier L., Wynendaele E., Gevaert B., De Spiegeleer B. (2017), "Chemical classification of cyclic depsipeptides", Current Protein and Peptide Science, 18(5), pp. 425-452.
174. Thomas M. B., Read A. F. (2007), "Fungal bioinsecticide with a sting", Nature Biotechnology, 25(12), pp. 1367-1368.
175. Thompson J. D., Gibson T. J., Plewniak F., Jeanmougin F., Higgins D. G. (1997), "The CLUSTAL_X windows interface: flexible strategies for multiple sequence alignment aided by quality analysis tools", Nucleic acids research, 25(24), pp. 4876-4882.
176. Tian J., Han J. J., Zhang X., He L. W., Zhang Y. J., Bao L., Liu H. W. (2016), "New Cyclohexadepsipeptides from an Entomogenous Fungus Fusarium proliferatum and Their Cytotoxicity and Autophagy‐Inducing Activity", Chemistry & biodiversity, 13(7), pp. 852-860.
177. Tomoda H., Nishida H., Huang X. H., Masuma R., Kim Y. K., Omura S. (1992), "New cyclodepsipeptides, enniatins D, E and f produced by Fusarium sp. FO-1305Áü", The Journal of antibiotics, 45(8), pp. 1207-1215.
178. Tzean S. (1997), Atlas of Entomopathogenic Fungi from Taiwan: Department of Plant Pathology and Entomology, National Taiwan University, Taipei, Taiwan, 10617, ROC, Council of agriculture, executive yuan.
179. Uhlig S., Ivanova L., Petersen D., Kristensen R. (2009), "Structural studies on minor enniatins from Fusarium sp. VI 03441: novel N-methyl-threonine containing enniatins", Toxicon, 53(7-8), pp. 734-742.
180. Umeyama A., Takahashi K., Grudniewska A., Shimizu M., Hayashi S., Kato M., Okamoto Y., Suenaga M., Ban S., Kumada T. (2014), "In vitro antitrypanosomal activity of the cyclodepsipeptides, cardinalisamides A - C, from the insect pathogenic fungus Cordyceps cardinalis NBRC 103832", The Journal of antibiotics, 67(2), pp. 163-166.
181. Urbaniak M., Stępień Ł., Uhlig S. (2019), "Evidence for naturally produced beauvericins containing N-Methyl-Tyrosine in hypocreales fungi", Toxins, 11(3), pp. 182.
182. Urry L. A., Cain M. L., Wasserman S. A., Minorsky P. V., Reece J. B. (2017), Campbell biology, Pearson Education, Incorporated.
183. Valencia J. W. A., Bustamante A. L. G., Jiménez A. V., Grossi-de-Sá M. F. (2011), "Cytotoxic activity of fungal metabolites from the pathogenic fungus Beauveria bassiana: an intraspecific evaluation of beauvericin production", Current microbiology, 63(3), pp. 306.
184. Van N. T. T., Viet N. D., Lam D. M. (2021), "Effects of Culture Conditions on Growth and Cyclooligomer Depsipeptides Biosynthesis of Cordyceps sp. CPA14V", VNU Journal of Science: Natural Sciences and Technology, 38(1).
185. Vanden Berghe D. (1991), "Screening methods for antibacterial and antiviral agents from higher plants", Methods in plant biochemistry, pp. 47-69.
186. Vega F. E. (2018), "The use of fungal entomopathogens as endophytes in biological control: a review", Mycologia, 110(1), pp. 4-30.
187. Vikhe A., Dale N., Umbarkar R., Labade G., Savant A., Walunj A. (2016), "In Vitro and In Vivo induction and characterization of toxins isolated from Beauveria bassiana", International Journal of Pure & Applied Bioscience, 4(3), pp. 97-103.
188. Vilgalys R., Hester M. (1990), "Rapid genetic identification and mapping of enzymatically amplified ribosomal DNA from several Cryptococcus species", Journal of bacteriology, 172(8), pp. 4238-4246.
189. Visconti A., Blais L. A., ApSimon J. W., Greenhalgh R., Miller J. D. (1992), "Production of enniatins by Fusarium acuminatum and Fusarium compactum in liquid culture: isolation and characterization of three new enniatins, B2, B3, and B4", Journal of Agricultural and Food Chemistry, 40(6), pp. 1076-1082.
190. Vongvanich N., Kittakoop P., Isaka M., Trakulnaleamsai S., Vimuttipong S., Tanticharoen M., Thebtaranonth Y. (2002), "Hirsutellide a, a new antimycobacterial cyclohexadepsipeptide from the entomopathogenic fungus hirsutella k obayasii", Journal of natural products, 65(9), pp. 1346-1348.
191. Vongvilai P., Isaka M., Kittakoop P., Srikitikulchai P., Kongsaeree P., Prabpai S., Thebtaranonth Y. (2004), "Isolation and structure elucidation of enniatins L, M1, M2, and N: novel hydroxy analogs", Helvetica chimica acta, 87(8), pp. 2066-2073.
192. Wang C. C., Wu J. Y., Chang C. Y., Yu S. T., Liu Y. C. (2019), "Enhanced exopolysaccharide production by Cordyceps militaris using repeated batch cultivation", Journal of bioscience and bioengineering, 127(4), pp. 499-505.
193. Wang J., Zhang D. M., Jia J. F., Peng Q. L., Tian H. Y., Wang L., Ye W. C. (2014), "Cyclodepsipeptides from the ascocarps and insect-body portions of fungus Cordyceps cicadae", Fitoterapia, 97, pp. 23-27.
194. Wang Q., Xu L. (2012), "Beauvericin, a bioactive compound produced by fungi: a short review", Molecules, 17(3), pp. 2367-2377.
195. Wang X.-L., Yao Y.-J. (2011), "Host insect species of Ophiocordyceps sinensis: a review", ZooKeys, (127), pp. 43.
196. Wang X., Gong X., Li P., Lai D., Zhou L. (2018), "Structural diversity and biological activities of cyclic depsipeptides from fungi", Molecules, 23(1), pp. 169.
197. Wang Y., Ke A., Wang F., Zhang X., Fan Y., Lu X., Zheng Z., Jiang Q., Zhang H., Zhao B. (2011), "F04W2166A, a proteasome inhibitor from fungal metabolites", Chin. J. Antibiot, 9, pp. 662-666.
198. Weckwerth W., Miyamoto K., Iinuma K., Krause M., Glinski M., Storm T., Bonse G., Kleinkauf H., Zocher R. (2000), "Biosynthesis of PF1022A and related cyclooctadepsipeptides", Journal of Biological Chemistry, 275(23), pp. 17909-17915.
199. Weng Q., Zhang X., Chen W., Hu Q. (2019), "Secondary metabolites and the risks of Isaria fumosorosea and Isaria farinosa", Molecules, 24(4), pp. 664.
200. Whittaker R. H. (1969), "New concepts of kingdoms of organisms", Science, 163(3863), pp. 150-160.
201. Xu F. (2018), "Identification and Engineering of Nonribosomal Peptide Biosynthetic Systems".
202. Xu L., Wang J., Zhao J., Li P., Shan T., Wang J., Li X., Zhou L. (2010), "Beauvericin from the endophytic fungus, Fusarium redolens, isolated from Dioscorea zingiberensis and its antibacterial activity", Natural Product Communications, 5(5), pp. 1934578X1000500527.
203. Xu L. J., Liu Y. S., Zhou L. G., Wu J. Y. (2010), "Optimization of a liquid medium for beauvericin production in Fusarium redolens Dzf2 mycelial culture", Biotechnology and Bioprocess Engineering, 15(3), pp. 460-466.
204. Xu Y., Orozco R., Wijeratne E. K., Espinosa-Artiles P., Gunatilaka A. L., Stock S. P., Molnár I. (2009), "Biosynthesis of the cyclooligomer depsipeptide bassianolide, an insecticidal virulence factor of Beauveria bassiana", Fungal Genetics and Biology, 46(5), pp. 353-364.
205. Xu Y., Orozco R., Wijeratne E. K., Gunatilaka A. L., Stock S. P., Molnár I. (2008), "Biosynthesis of the cyclooligomer depsipeptide beauvericin, a virulence factor of the entomopathogenic fungus Beauveria bassiana", Chemistry & biology, 15(9), pp. 898-907.
206. Xu Y., Zhan J., Wijeratne E. K., Burns A. M., Gunatilaka A. L., Molnár I. (2007), "Cytotoxic and antihaptotactic beauvericin analogues from precursor-directed biosynthesis with the insect pathogen Beauveria bassiana ATCC 7159", Journal of natural products, 70(9), pp. 1467-1471.
207. Yang G. Z., Li Y. C. (2002), "Cyclopeptide and Terpenoids from Tripterygium wilfordii Hook", Helvetica chimica acta, 85(1), pp. 168-174.
208. Ye X., Anjum K., Song T., Wang W., Liang Y., Chen M., Huang H., Lian X.-Y., Zhang Z. (2017), "Antiproliferative cyclodepsipeptides from the marine actinomycete Streptomyces sp. P11-23B downregulating the tumor metabolic enzymes of glycolysis, glutaminolysis, and lipogenesis", Phytochemistry, 135, pp. 151-159.
209. Yu D., Xu F., Zhang S., Zhan J. (2017), "Decoding and reprogramming fungal iterative nonribosomal peptide synthetases", Nature communications, 8, pp. 15349.
210. Yu D., Xu F., Zi J., Wang S., Gage D., Zeng J., Zhan J. (2013), "Engineered production of fungal anticancer cyclooligomer depsipeptides in Saccharomyces cerevisiae", Metabolic engineering, 18, pp. 60-68.
211. Zaher A. M., Makboul M. A., Moharram A. M., Tekwani B. L., Calderón A. I. (2015), "A new enniatin antibiotic from the endophyte Fusarium tricinctum Corda", The Journal of antibiotics, 68(3), pp. 197-200.
212. Zala S. P., Patel K. P., Patel K. S., Parmar J. P., Sen D. J. (2012), "Laboratory techniques of purification and isolation", Int. J. Drug Dev. Res, 4(2), pp. 41-55.
213. Zhan J., Burns A. M., Liu M. X., Faeth S. H., Gunatilaka A. L. (2007), "Search for cell motility and angiogenesis inhibitors with potential anticancer activity: beauvericin and other constituents of two endophytic strains of Fusarium oxysporum", Journal of natural products, 70(2), pp. 227-232.
214. Zhang C., Jiang L., Wang Z. (2021), "Effect of coix seed on exopolysaccharide production of Cordyceps militaris in liquid culture", Arabian Journal of Chemistry, 14(3), pp. 102999.
215. Zhang H., Ruan C., Bai X., Zhang M., Zhu S., Jiang Y. (2016), "Isolation and identification of the antimicrobial agent beauvericin from the endophytic Fusarium oxysporum 5-19 with NMR and ESI-MS/MS", BioMed research international, 2016.
216. Zhang L., Fasoyin O. E., Molnár I., Xu Y. (2020), "Secondary metabolites from hypocrealean entomopathogenic fungi: novel bioactive compounds", Natural Product Reports.
217. Zhang L., Yan K., Zhang Y., Huang R., Bian J., Zheng C., Sun H., Chen Z., Sun N., An R. (2007), "High-throughput synergy screening identifies microbial metabolites as combination agents for the treatment of fungal infections", Proceedings of the National Academy of Sciences, 104(11), pp. 4606-4611.
218. Zhang X., Hu Q., Weng Q. (2019), "Secondary metabolites (SMs) of Isaria cicadae and Isaria tenuipes", RSC advances, 9(1), pp. 172-184.
219. Zhou Y.-M., Xie W., Ye J.-Q., Zhang T., Li D.-Y., Zhi J.-R., Zou X. (2020), "New potential strains for controlling Spodoptera frugiperda in China: Cordyceps cateniannulata and Metarhizium rileyi", BioControl, 65(6), pp. 663-672.
220. Zimmermann G. (2008), "The entomopathogenic fungi Isaria farinosa (formerly Paecilomyces farinosus) and the Isaria fumosorosea species complex (formerly Paecilomyces fumosoroseus): biology, ecology and use in biological control", Biocontrol science and technology, 18(9), pp. 865-901.
221. Zobel S., Kumpfmüller J., Süssmuth R. D., Schweder T. (2015), "Bacillus subtilis as heterologous host for the secretory production of the non-ribosomal cyclodepsipeptide enniatin", Applied microbiology and biotechnology, 99(2), pp. 681-691.
III. Website
222.
223. https://vuonquocgiaxuanson.com.vn/bao-ton-da-dang-sinh-hoc
PHỤ LỤC
1. Khả năng sinh trưởng của chủng nấm C. cateniannulata CPA14V trong 05 loại môi trường nghiên cứu
Thời gian nuôi cấy (ngày)
Khối lượng tế bào khô (g/l)
PBG
SBR
MM
CzD
FDM
1
2,6d±0,082
2,11c±0,055
2,91e±0,014
0,89a±0,014
1,09b±0,041
2
6,75e±0,014
4,99d±0,068
3,96c±0,055
2,96a±0,042
3,57b±0,028
3
9,44e±0,069
6,65d±0,014
5,52b±0,014
4,4a±0,136
6,08c±0,068
4
9,42d±0,022
7,68c±0,122
6,87b±0,055
5,43a±0,028
7,5c±0,124
5
9,89e±0,069
8,8d±0,124
7,81c±0,082
5,82a±0,095
7,33b±0,082
6
10,23e±0,109
9,84d±0,097
7,23a±0,082
8,06b±0,069
8,59c±0,096
7
11,55d±0,041
11,81d±0,136
7,14a±0,125
8,71b±0,191
9,09c±0,095
8
11,85d±0,014
12,76e±0,027
7,16a±0,055
8,43b±0,178
9,11c±0,136
9
11,48d±0,014
14,07e±0,055
6,86a±0,055
8,27b±0,028
8,62c±0,095
10
11,47c±0,055
15,36d±0,151
6,66a±0,055
8,2b±0,028
8,01b±0,041
11
11,07d±0,021
15,43e±0,082
6,63a±0,109
7,03b±0,027
7,97c±0,036
12
10,88d±0,041
15,29e±0,357
6,62a±0,063
7,15b±0,095
8,17c±0,028
(So sánh giữa các công thức trong cùng một hàng, các chữ cái khác nhau (a, b, c, d, e) thể hiện sự sai khác có ý nghĩa thống kê ở mức α=0,05 với độ tin cậy 95%)
2. Khả năng sinh tổng hợp COD của chủng nấm C. cateniannulata CPA14V trong 05 loại môi trường nghiên cứu
Thời gian nuôi cấy (ngày)
Hàm lượng COD (mg/g)
PBG
SBR
MM
CzD
FDM
1
0,438b±0,147
0,141a±0,012
0a±0,000
0a±0,000
0,035a±0,013
2
0,125ab±0,009
0,077a±0,003
0,101ab±0,002
0a±0,000
0,326b±0,214
3
0,204a±0,036
0,083a±0,013
0,35a±0,385
0,111a±0,008
0,07a±0,035
4
0,057a±0,023
0,047a±0,001
0,373a±0,413
0,11a±0,065
0,044a±0,032
5
0,382a±0,026
0,641a±0,021
0,121a±0,040
2,17b±0,844
0,13a±0,036
6
0,809a±0,265
4,306b±0,171
0,16a±0,088
6,452c±0,406
0,186a±0,004
7
0,785a±0,252
3,139b±0,444
0,24a±0,029
5,537c±0,307
0,116a±0,029
8
0,379a±0,042
2,51b±0,396
0,051a±0,037
5,334c±0,210
1,685b±0,530
9
0,382a±0,088
2,472b±0,970
0,21a±0,141
1,666ab±0,801
0,501a±0,279
10
0,055a±0,008
0,22a±0,011
0,202a±0,146
1,522b±0,225
0,201a±0,019
11
0,02a±0,008
0,197a±0,010
0,012a±0,005
2,385b±0,193
0,181a±0,004
12
0,006a±0,045
0,094a±0,069
0,104a±0,037
2,3b±0,644
0,477a±0,162
(So sánh giữa các công thức trong cùng một hàng, các chữ cái khác nhau (a, b, c) thể hiện sự sai khác có ý nghĩa thống kê ở mức α=0,05 với độ tin cậy 95%)
3. Ảnh hưởng của pH đến sự sinh trưởng và sinh tổng hợp COD của chủng C. cateniannulata CPA14V
pH
CDW (g/l)
COD (mg/g)
CDW x COD (mg/l)
3
0,067a ± 0,003
0a±0,000
0a±0,000
3,5
0,430ab ±0,08
0a±0,000
0a±0,000
4
0,604b ± 0,01
0a±0,000
0a±0,000
4,5
0,358ab± 0,041
0a±0,000
0a±0,000
5
0,412ab± 0,003
0a±0,000
0a±0,000
5,5
0,595b ± 0,016
0a±0,000
0a±0,000
6
1,258c ± 0,066
0a±0,000
0a±0,000
6,5
8,360d ± 0,107
4,963b ± 0,049
41,505b ± 0,116
7
8,270d ± 0,024
5,117b ± 0,130
42,318b ± 1,198
7,5
8,060d ± 0,144
5,783c ± 0,053
46,587c ± 0,429
8
8,200d ± 0,287
6,190d ± 0,090
50,774d ± 1,046
(So sánh các công thức trong cùng một cột, các chữ cái khác nhau (a,b,c) thể hiện sự sai khác có ý nghĩa thống kê ở mức α=0,05 với độ tin cậy 95%)
4. Ảnh hưởng của nguồn cacbon đến khả năng sinh trưởng và sinh tổng hợp COD của chủng C. cateniannulata CPA14V
Nguồn cacbon
CDW (g/l)
COD (mg/g)
CDW x COD (mg/l)
Fructose
9,395d ± 0,273
6,003cd ± 0,039
56,400e ± 0,228
Sucrose
8,359c ± 0,232
5,630c ± 0,057
47,049d ± 0,829
Glucose
10,205e ± 0,082
5,797c ± 0,078
59,155e ± 0,328
Lactose
6,697b ± 0,109
6,375d ± 0,139
42,706c ± 1,623
Tinh bột tan
6,574b ± 0,191
5,631c ± 0,299
36,960b ± 2,997
Glactose
6,575b ± 0,069
5,118b ± 0,086
33,666b ± 0,922
Mannitol
2,463a ± 0,302
4,327a ± 0,021
10,665a ± 1,357
(So sánh giữa các công thức, trong cùng một cột, các chữ cái khác nhau (a,b,c) thể hiện sự sai khác có ý nghĩa thống kê ở mức α=0,05 với độ tin cậy 95%)
5. Ảnh hưởng của nguồn nitơ đến khả năng sinh trưởng và sinh tổng hợp COD của chủng C. cateniannulata CPA14V
Nguồn Nitơ
CDW (g/l)
COD (mg/g)
CDW x COD (mg/l)
NaNO3
12,233f ± 0,249
4,967d ± 0,050
60,771fg ± 1,844
Cao nấm men
13,524g ± 0,313
4,863d ± 0,049
65,789g ± 2,186
Pepton
10,456d ± 0,204
5,156de ± 0,048
53,902de ± 0,619
Cao thịt
14,403h ± 0,055
4,189c ± 0,104
60,330fg ± 1,280
KNO3
11,404e ± 0,151
4,905d ± 0,163
55,961ef ± 2,598
NH4Cl
7,592a ± 0,069
2,817a ± 0,132
21,393a ± 1,189
NH4NO3
8,739b ± 0,136
4,323c ± 0,088
37,793b ± 1,336
(NH4)2SO4
9,457c ± 0,252
3,880b ± 0,099
36,717b ± 1,923
NH4HCO3
7,413a ± 0,237
6,330e ± 0,126
46,956c ± 2,446
MSG
8,683b ± 0,183
5,700f ± 0,159
49,524cd ± 2,405
(So sánh giữa các công thức trong cùng một cột, các chữ cái khác nhau (a,b,c) thể hiện sự sai khác có ý nghĩa thống kê ở mức α=0,05 với độ tin cậy 95%)
6. Ảnh hưởng của dung môi chiết đến hàm lượng CC1
Hàm lượng
(%)
Hệ dung môi
n-hexane (H)
dicholoro-methane (D)
ethyl acetate (E)
Ethanol (M)
CC1
0,129±0,013
0,376±0,020
0,355±0,026
0,311±0,01
7. Ảnh hưởng của nhiệt độ đến hàm lượng CC1
Hàm lượng
(%)
Nhiệt độ
20oC
30oC
40oC
50oC
60oC
CC1
0,292±0,01
0,308±0,016
0,326±0,024
0,376±0,012
0,378±0,02
8. Ảnh hưởng của thời gian siêu âm đến hàm lượng CC1
Hàm lượng
(%)
Thời gian
1h
2h
3h
4h
CC1
0,281±0,023
0,370±0,015
0,377±0,02
0,376±0,02
9. Trình tự gen ITS, LSU và Rpb1 của các chủng nấm ký sinh côn trùng nghiên cứu
LOCUS OK310721 521 bp DNA linear PLN 03-OCT-2021
DEFINITION Beauveria sp. strain CPA5 internal transcribed spacer 1, partial
sequence; 5.8S ribosomal RNA gene and internal transcribed spacer
2, complete sequence; and large subunit ribosomal RNA gene, partial
sequence.
ACCESSION OK310721
VERSION OK310721.1
KEYWORDS .
SOURCE Beauveria sp.
ORGANISM Beauveria sp.
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae;
Beauveria; unclassified Beauveria.
REFERENCE 1 (bases 1 to 521)
AUTHORS Lam,D.M., Van,N.T. and Viet,N.D.
TITLE Direct Submission
JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national
university of education, xuanthuy, Hanoi 122000, Viet Nam
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..521
/organism="Beauveria sp."
/mol_type="genomic DNA"
/strain="CPA5"
/db_xref="taxon:1891652"
misc_RNA 521
/note="contains internal transcribed spacer 1, 5.8S
ribosomal RNA, internal transcribed spacer 2, and large
subunit ribosomal RNA"
ORIGIN
1 cattaccgag ttttcaactc cctaaccctt ctgtgaacct acctatcgtt gcttcggcgg
61 actcgcccca gcccggacgc ggactggacc agcggcccgc cggggacctc aaactcttgt
121 attccagcat cttctgaata cgccgcaagg caaaacaaat gaatcaaaac tttcaacaac
181 ggatctcttg gctctggcat cgatgaagaa cgcagcgaaa tgcgataagt aatgtgaatt
241 gcagaatcca gtgaatcatc gaatctttga acgcacattg cgcccgccag cattctggcg
301 ggcatgcctg ttcgagcgtc atttcaaccc tcgacctccc ctgggggagg tcggcgttgg
361 ggaccggcag cacaccgccg gccctgaaat ggagtggcgg cccgtccgcg gcgacctctg
421 cgtagtaata cagctcgcac cggaaccccg acgcggccac gccgtaaaac acccaacttc
481 tgaacgttga cctcgaatca ggtaggacta cccgctgaac t
//
LOCUS OK310722 520 bp DNA linear PLN 03-OCT-2021
DEFINITION Beauveria sp. strain XS37 internal transcribed spacer 1, partial
sequence; 5.8S ribosomal RNA gene and internal transcribed spacer
2, complete sequence; and large subunit ribosomal RNA gene, partial
sequence.
ACCESSION OK310722
VERSION OK310722.1
KEYWORDS .
SOURCE Beauveria sp.
ORGANISM Beauveria sp.
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae;
Beauveria; unclassified Beauveria.
REFERENCE 1 (bases 1 to 520)
AUTHORS Lam,D.M., Van,N.T. and Viet,N.D.
TITLE Direct Submission
JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national
university of education, xuanthuy, Hanoi 122000, Viet Nam
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..520
/organism="Beauveria sp."
/mol_type="genomic DNA"
/strain="XS37"
/db_xref="taxon:1891652"
misc_RNA 520
/note="contains internal transcribed spacer 1, 5.8S
ribosomal RNA, internal transcribed spacer 2, and large
subunit ribosomal RNA"
ORIGIN
1 cattaccgag ttttcaactc cctaaccctt ctgtgaacct acctatcgtt gcttcggcgg
61 actcgcccca gcccggacgc ggactggacc agcggcccgc cggggacctc aaactcttgt
121 attccagcat cttctgaata cgccgcaagg cacaacaaat gaatcaaaac tttcaacaac
181 ggatctcttg gctctggcat cgatgaagaa cgcagcgaaa tgcgataagt aatgtgaatt
241 gcagaatcca gtgaatcatc gaatctttga acgcacattg cgcccgccag cattctggcg
301 ggcatgcctg ttcgagcgtc atttcaaccc tcgacctccc cttggggagg tcggcgttgg
361 ggaccggcag cacaccgccg gccctgaaat ggagtggcgg cccgtccgcg gcgacctctg
421 cgtagtaata cagctcgcac cggaaccccg acgcggccac gccgtaaaac acccaacttc
481 tgaacgttga cctcgaatca ggtaggacta cccgctgaac
//
LOCUS OK310723 521 bp DNA linear PLN 03-OCT-2021
DEFINITION Beauveria sp. strain XS38 internal transcribed spacer 1, partial
sequence; 5.8S ribosomal RNA gene and internal transcribed spacer
2, complete sequence; and large subunit ribosomal RNA gene, partial
sequence.
ACCESSION OK310723
VERSION OK310723.1
KEYWORDS .
SOURCE Beauveria sp.
ORGANISM Beauveria sp.
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae;
Beauveria; unclassified Beauveria.
REFERENCE 1 (bases 1 to 521)
AUTHORS Lam,D.M., Van,N.T. and Viet,N.D.
TITLE Direct Submission
JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national
university of education, xuanthuy, Hanoi 122000, Viet Nam
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..521
/organism="Beauveria sp."
/mol_type="genomic DNA"
/strain="XS38"
/db_xref="taxon:1891652"
misc_RNA 521
/note="contains internal transcribed spacer 1, 5.8S
ribosomal RNA, internal transcribed spacer 2, and large
subunit ribosomal RNA"
ORIGIN
1 cattaccgag ttttcaactc cctaaccctt ctgtgaacct acctatcgtt gcttcggcgg
61 actcgcccca gcccggacgc ggactggacc agcggcccgc cggggacctc aaactcttgt
121 attccagcat cttctgaata cgccgcaagg cacaacaaat gaatcaaaac tttcaacaac
181 ggatctcttg gctctggcat cgatgaagaa cgcagcgaaa tgcgataagt aatgtgaatt
241 gcagaatcca gtgaatcatc gaatctttga acgcacattg cgcccgccag cattctggcg
301 ggcatgcctg ttcgagcgtc atttcaaccc tcgacctccc cttggggagg tcggcgttgg
361 ggaccggcag cacaccgccg gccctgaaat ggagtggcgg cccgtccgcg gcgacctctg
421 cgtagtaata cagctcgcac cggaaccccg acgcggccac gccgtaaaac acccaacttc
481 tgaacgttga cctcgaatca ggtaggacta cccgctgaac t
//
LOCUS OK310724 521 bp DNA linear PLN 03-OCT-2021
DEFINITION Cordyceps sp. strain CPA13V internal transcribed spacer 1, partial
sequence; 5.8S ribosomal RNA gene and internal transcribed spacer
2, complete sequence; and large subunit ribosomal RNA gene, partial
sequence.
ACCESSION OK310724
VERSION OK310724.1
KEYWORDS .
SOURCE Cordyceps sp.
ORGANISM Cordyceps sp.
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae;
Cordyceps.
REFERENCE 1 (bases 1 to 521)
AUTHORS Lam,D.M., Van,N.T. and Viet,N.D.
TITLE Direct Submission
JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national
university of education, xuanthuy, Hanoi 122000, Viet Nam
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..521
/organism="Cordyceps sp."
/mol_type="genomic DNA"
/strain="CPA13V"
/db_xref="taxon:1755423"
misc_RNA 521
/note="contains internal transcribed spacer 1, 5.8S
ribosomal RNA, internal transcribed spacer 2, and large
subunit ribosomal RNA"
ORIGIN
1 cattaccgag ttttcaactc cccaaccctt ctgtgaacct acctatcgtt gcttcggcgg
61 actcgcccca gcccggacgc ggactggacc agcggcccgc cggggacctc aaactcttgt
121 attccagcat cttctgaata cgccgcaagg caaaacaaat gaatcaaaac tttcaacaac
181 ggatctcttg gctctggcat cgatgaagaa cgcagcgaaa tgcgataagt aatgtgaatt
241 gcagaatcca gtgaatcatc gaatctttga acgcacattg cgcccgccag cattctggcg
301 ggcatgcctg ttcgagcgtc atttcaaccc tcgacctccc cttggggagg tcggcgttgg
361 ggaccggcag cacaccgccg gccctgaaat ggagtggcgg cccgtccgcg gcgacctctg
421 cgtagtaata cagctcgcac cggaaccccg acgcggccac gccgtaaaac acccaacttc
481 tgaacgttga cctcgaatca ggtaggacta cccgctgaac t
//
LOCUS OK310725 586 bp DNA linear PLN 03-OCT-2021
DEFINITION Cordyceps sp. strain CPA31 small subunit ribosomal RNA gene,
partial sequence; internal transcribed spacer 1, 5.8S ribosomal RNA
gene, and internal transcribed spacer 2, complete sequence; and
large subunit ribosomal RNA gene, partial sequence.
ACCESSION OK310725
VERSION OK310725.1
KEYWORDS .
SOURCE Cordyceps sp.
ORGANISM Cordyceps sp.
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae;
Cordyceps.
REFERENCE 1 (bases 1 to 586)
AUTHORS Lam,D.M., Van,N.T. and Viet,N.D.
TITLE Direct Submission
JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national
university of education, xuanthuy, Hanoi 122000, Viet Nam
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..586
/organism="Cordyceps sp."
/mol_type="genomic DNA"
/strain="CPA31"
/db_xref="taxon:1755423"
misc_RNA 586
/note="contains small subunit ribosomal RNA, internal
transcribed spacer 1, 5.8S ribosomal RNA, internal
transcribed spacer 2, and large subunit ribosomal RNA"
ORIGIN
1 aacaaggttt ccgttggtga accagcggag ggatcattac cgagttttca actccctaac
61 cctttgtgaa catacctatc gttgcttcgg cggactcgcc ccggcgtccg gacggccttg
121 cgccgcccgc ggcccggacc caggcggccg ccggagaacc ttaaactctg tttccatcag
181 tctctctgaa tccgccgcaa ggcaaaacaa atgaatcaaa actttcaaca acggatctct
241 tggttctggc atcgatgaag aacgcagcga aatgcgataa gtaatgtgaa ttgcagaatt
301 cagtgaatca tcgaatcttt gaacgcacat tgcgcccgcc agcattctgg cgggcatgcc
361 tgttcgagcg tcatttcaac cctcgacacc ccttcggggg agtcggcgtt ggggaccggc
421 agcacaccgc cggccccgaa atacagtggc ggcccgtccg cggcgacctc tgcgtagtac
481 tccaacgcgc accgggaacc cgacgcggcc acgccgttaa ccaccccact tctgaacgtt
541 gacctcggat caggtaggac tacccgctga acttaagcat atcaat
//
LOCUS OK310726 586 bp DNA linear PLN 03-OCT-2021
DEFINITION Cordyceps sp. strain XS67 small subunit ribosomal RNA gene, partial
sequence; internal transcribed spacer 1, 5.8S ribosomal RNA gene,
and internal transcribed spacer 2, complete sequence; and large
subunit ribosomal RNA gene, partial sequence.
ACCESSION OK310726
VERSION OK310726.1
KEYWORDS .
SOURCE Cordyceps sp.
ORGANISM Cordyceps sp.
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae;
Cordyceps.
REFERENCE 1 (bases 1 to 586)
AUTHORS Lam,D.M., Van,N.T. and Viet,N.D.
TITLE Direct Submission
JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national
university of education, xuanthuy, Hanoi 122000, Viet Nam
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..586
/organism="Cordyceps sp."
/mol_type="genomic DNA"
/strain="XS67"
/db_xref="taxon:1755423"
misc_RNA 586
/note="contains small subunit ribosomal RNA, internal
transcribed spacer 1, 5.8S ribosomal RNA, internal
transcribed spacer 2, and large subunit ribosomal RNA"
ORIGIN
1 gggaagtaaa aaatcgtaac aaggtctccg ttggtgaacc agcggaggga tcattaccag
61 agttttacaa ctcccaaccc ttctgtgaac ctacccatcg ttgcttcggc ggactcgccc
121 cagcgtccgg acggccccgc gccggcccgc gacccggacc caggcggccg ccggagacca
181 cgcaaccctg tatccatcag tctctctgaa tccgccgcaa ggcaacacaa atgaatcaaa
241 actttcaaca acggatctct tggttctggc atcgatgaag aacgcagcga aatgcgatac
301 gtaatgtgaa aggcagaatt ccgcgaatca tcgaatcttt gaacgcacat tgcgcccgcc
361 agcattctgg cgggcatgcc tgttcgagcg tcatttcaac cctcgacgtc ccccgggacg
421 tcggccttgg ggaccggcag caccccgccg gccctgaaat ggagtggcgg cccgtccgcg
481 gcgacctctg cgcagtacaa ccactcgcac cgggaacccg acgcggcccg ccgtgaaacc
541 cccaacctct gaacgctgac ctcggatcag gtagactccc ccgggg
//
LOCUS OK310727 578 bp DNA linear PLN 03-OCT-2021
DEFINITION Isaria sp. strain CPA40 small subunit ribosomal RNA gene, partial
sequence; internal transcribed spacer 1, 5.8S ribosomal RNA gene,
and internal transcribed spacer 2, complete sequence; and large
subunit ribosomal RNA gene, partial sequence.
ACCESSION OK310727
VERSION OK310727.1
KEYWORDS .
SOURCE Isaria sp.
ORGANISM Isaria sp.
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae;
Isaria; unclassified Isaria.
REFERENCE 1 (bases 1 to 578)
AUTHORS Lam,D.M., Van,N.T. and Viet,N.D.
TITLE Direct Submission
JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national
university of education, xuanthuy, Hanoi 122000, Viet Nam
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..578
/organism="Isaria sp."
/mol_type="genomic DNA"
/strain="CPA40"
/db_xref="taxon:1906752"
misc_RNA 578
/note="contains small subunit ribosomal RNA, internal
transcribed spacer 1, 5.8S ribosomal RNA, internal
transcribed spacer 2, and large subunit ribosomal RNA"
ORIGIN
1 atcaggtctc gttggtgacc agcggaggga tcattaccag aggttacaac tcccaaccct
61 tctgtgaacc tacccatagt tgcttcggcg gacccgcccc agcgtccgga cggcccagcg
121 ccggcccgcg acctggaccc aggcggccgc cggggaccac gcaaccctgt atctgtcagc
181 ctctctgaat ccgccgcaag gcaacacaaa cgaatcaaaa ctttcaacaa cggatctctt
241 ggttctggca tcgatgaaga acgcagcgaa atgcgatacg taatgtgaat tgcagaattc
301 cgtgaatcat cgaatctttg aacgcacatt gcgcccgcca gcattctggc gggcatgcct
361 gttcgagcgt caattcaaac ctcgacgtcc cccgggacgt cggccttggg gaccggcagc
421 accccgccgg ccctgaaatg gagtggcggc ccgtccgcgg cgacctctgc gcagtacaag
481 cactcgcacc gggaacccga cgcggcccgc cgtgaaaccc ccaacctctg aacgttgacc
541 tcggatcagg taggactacc cgctgaactt aagcatat
//
LOCUS OK310728 584 bp DNA linear PLN 03-OCT-2021
DEFINITION Ophiocordyceps sp. strain CPA1 small subunit ribosomal RNA gene,
partial sequence; internal transcribed spacer 1, 5.8S ribosomal RNA
gene, and internal transcribed spacer 2, complete sequence; and
large subunit ribosomal RNA gene, partial sequence.
ACCESSION OK310728
VERSION OK310728.1
KEYWORDS .
SOURCE Ophiocordyceps sp.
ORGANISM Ophiocordyceps sp.
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Hypocreomycetidae; Hypocreales;
Ophiocordycipitaceae; Ophiocordyceps.
REFERENCE 1 (bases 1 to 584)
AUTHORS Lam,D.M., Van,N.T. and Viet,N.D.
TITLE Direct Submission
JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national
university of education, xuanthuy, Hanoi 122000, Viet Nam
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..584
/organism="Ophiocordyceps sp."
/mol_type="genomic DNA"
/strain="CPA1"
/db_xref="taxon:1912256"
misc_RNA 584
/note="contains small subunit ribosomal RNA, internal
transcribed spacer 1, 5.8S ribosomal RNA, internal
transcribed spacer 2, and large subunit ribosomal RNA"
ORIGIN
1 cgtttagtct cgttggtgac cagcggagga atcattacca gagttttaca actcccaacc
61 cttctgtgaa cctacccata gttgcttcgg cggacccgcc ccagcgtccg gacggcccag
121 cgccggcccg cgacctggac ccaggcggcc gccggggacc acgcaaccct gtatctgtca
181 gcctctctga atccgccgca aggcaacaca aacgaatcaa aactttcaac aacggatctc
241 ttggttctgg catcgatgaa gaacgcagcg aaatgcgata cgtaatgtga attgcagaat
301 tccgtgaatc atcgaatctt tgaacgcaca ttgcgcccgc cagcattctg gcgggcatgc
361 ctgttcgagc gtcatttcaa ccctcgacgt cccccgggac gtcggccttg gggaccggca
421 gcaccccgcc ggccctgaaa tggagtggcg gcccgtccgc ggcgacctct gcgcagtaca
481 agcactcgca ccgggaaccc gacgcggccg gccgtgaaac ccccaacctc tgaacgttga
541 cctcggatca ggtaggacta cccgctgaac ttaagcatat taaa
//
LOCUS OK310729 563 bp DNA linear PLN 03-OCT-2021
DEFINITION Purpureocillium sp. strain XS77 internal transcribed spacer 1,
partial sequence; 5.8S ribosomal RNA gene and internal transcribed
spacer 2, complete sequence; and large subunit ribosomal RNA gene,
partial sequence.
ACCESSION OK310729
VERSION OK310729.1
KEYWORDS .
SOURCE Purpureocillium sp.
ORGANISM Purpureocillium sp.
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Hypocreomycetidae; Hypocreales;
Ophiocordycipitaceae; Purpureocillium; unclassified
Purpureocillium.
REFERENCE 1 (bases 1 to 563)
AUTHORS Lam,D.M., Van,N.T. and Viet,N.D.
TITLE Direct Submission
JOURNAL Submitted (28-SEP-2021) faculty of biology, hanoi national
university of education, xuanthuy, Hanoi 122000, Viet Nam
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..563
/organism="Purpureocillium sp."
/mol_type="genomic DNA"
/strain="XS77"
/db_xref="taxon:1926681"
misc_RNA 563
/note="contains internal transcribed spacer 1, 5.8S
ribosomal RNA, internal transcribed spacer 2, and large
subunit ribosomal RNA"
ORIGIN
1 cagcggaggg atcattaccg agttatacaa ctcccaaacc cactgtgaac cttacctcag
61 ttgcctcggc gggaacgccc cggccgcctg cccccgcgcc ggcgccggac ccaggcgccc
121 gccgcaggga ccccaaactc tcttgcatta cgcccagcgg gcggaatttc ttctctgagt
181 tgcacaagca aaaacaaatg aatcaaaact ttcaacaacg gatctcttgg ttctggcatc
241 gatgaagaac gcagcgaaat gcgataagta atgtgaattg cagaattcag tgaatcatcg
301 aatctttgaa ggcacattgc gcccgccagc attctggcgg gcatgcctgt tcgagcgtca
361 tttcaaccct cgagcccccc ggggggcctc ggtgttgggg gacggcacac cagccgcccc
421 cgaaatgcag tggcgacccc gccgcagcct cccctgcgta gtagcacaca cctcgcaccg
481 gagcgcggag gcggtcacgc cgtaaaacgc ccaactttct tagagttgac ctcggatcag
541 gtaggaatac ccgctgaact taa
//
LOCUS MK634637 554 bp DNA linear PLN 26-AUG-2021
DEFINITION Cordyceps sp. isolate CPA14V small subunit ribosomal RNA gene,
partial sequence; internal transcribed spacer 1 and 5.8S ribosomal
RNA gene, complete sequence; and internal transcribed spacer 2,
partial sequence.
ACCESSION MK634637
VERSION MK634637.2
SOURCE Cordyceps sp.
ORGANISM Cordyceps sp.
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae;
Cordyceps.
REFERENCE 1 (bases 1 to 554)
AUTHORS Lam,D.M. and Van,N.T.T.
TITLE Direct Submission
JOURNAL Submitted (15-MAR-2019) faculty of biology, 1991, 29, Ha noi
122000, Viet Nam
COMMENT On Aug 26, 2021 this sequence version replaced MK634637.1.
##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..554
/organism="Cordyceps sp."
/mol_type="genomic DNA"
/isolate="CPA14V"
/db_xref="taxon:1755423"
misc_RNA 554
/note="contains small subunit ribosomal RNA, internal
transcribed spacer 1, 5.8S ribosomal RNA, and internal
transcribed spacer 2"
ORIGIN
1 aacaaggtct ccgttggtga accagcggag ggatcattac cagagttttt acaactccca
61 acccttctgt gaacctacct atcgttgctt cggcggactc gccccagcgt ccggacggcc
121 ccgcgccggc ccgcgacctg gacccaggcg gccgccggag gccccacaac cctgtatcca
181 tcagtctctc tgaatccgcc gcaaggcaaa caaatgaatc aaaactttca acaacggatc
241 tcttggttct ggcatcgatg aagaacgcag cgaaacgcga taagtaatgt gaattgcaga
301 atttagtgaa tcatcgaatc tttgaacgca cattgcgccc gccagcattc tggcgggcat
361 gcctgttcga gcgtcatttc aaccctcgac gtcccctggg gacgtcggcc ttggggaccg
421 gcagcacacc gccggccctg aaatcgagtg gcggcccgtc cgcggcgacc tctgcgcagt
481 actccagctc gcaccgggac cccgacgcgg ccacgccgta aaacacccaa ctctgaacgt
541 tgacctcgga tcag
//
LOCUS MZ923986 852 bp DNA linear PLN 26-AUG-2021
DEFINITION Cordyceps sp. isolate CPA14V large subunit ribosomal RNA gene,
partial sequence.
ACCESSION MZ923986
VERSION MZ923986
SOURCE Cordyceps sp.
ORGANISM Cordyceps sp.
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae;
Cordyceps.
REFERENCE 1 (bases 1 to 852)
AUTHORS Duong,L.M. and Nguyen,V.T.
TITLE Direct Submission
JOURNAL Submitted (26-AUG-2021) faculty of biology, hanoi national
university of education, xuanthuy, Hanoi 122000, Viet Nam
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..852
/organism="Cordyceps sp."
/mol_type="genomic DNA"
/isolate="CPA14V"
/db_xref="taxon:1755423"
rRNA 852
/product="large subunit ribosomal RNA"
ORIGIN
1 gggattgccc cagtaacggc gagtgaagcg gcaacagctc aaatttgaaa tctggccccc
61 gggtccgagt tgtaatttgc agaggatgct ttgggcgagg tgccttccga gttccctgga
121 acgggacgcc acagagggtg agagccccgt ctggtcggac accgagcccg tgtaaagctc
181 cttcgacgag tcgagtagtt tgggaatgct gctcaaaatg ggaggtatat gtcttctaaa
241 gctaaatatt ggccagagac cgatagcgca caagtagagt gatcgaaaga tgaaaagcac
301 tttgaaaaga gggttaaaaa gtacgtgaaa ttgttgaaag ggaagcgcct atgaccagac
361 ttgggcccgg tgaatcatcc agcgttctcg ctggtgcact ttgccgggca caggccagca
421 tcagtttggc gcgggggaca aaggcttcgg gaatgtggct ccctcgggag tgttatagcc
481 cgctgcgtaa taccctgcgc cggactgagg tacgcgcatc gcaaggatgc tggcgtaatg
541 gtcatcagcg acccgtcttg aaacacggac caaggagtcg tcttcgtatg cgagtgttcg
601 ggtgtcaaac ccctacgcgg aatgaaagtg aacgcaggtg agagcttcgg cgcatcatcg
661 accgatcctg atgttctcgg atggatttga gtaagagcat acggggccgg acccgaaaga
721 aggtgaacta tgcctgtata gggtgaagcc agaggaaact ctggtggagg ctcgcagcgg
781 ttctgacgtg cgaatcgatc gtcaaatatg ggcatggggg cgaaagacta atcgaacctt
841 ctagtagctg gt
//
LOCUS Seq1 570 bp RNA linear PLN 27-AUG-2021
DEFINITION Cordyceps sp. CPA14V.
ACCESSION Seq1
VERSION
SOURCE Cordyceps sp.
ORGANISM Cordyceps sp.
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae;
Cordyceps.
REFERENCE 1 (bases 1 to 570)
AUTHORS Duong,L.M. and Nguyen,V.T.T.
TITLE Direct Submission
JOURNAL Submitted (27-AUG-2021) biology, Hanoi national university of
education, Xuan thuy, Hanoi, Hanoi 122000, Vietnam
COMMENT Bankit Comment: ALT EMAIL:tranloan2910@gmail.com
Bankit Comment: TOTAL # OF SEQS:1
##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..570
/organism="Cordyceps sp."
/mol_type="other RNA"
/db_xref="taxon:1755423"
gene 1..>570
/gene="RPB1"
CDS 1..>570
/gene="RPB1"
/note="ARN polymerase II large subunit"
/codon_start=1
/product="ARN polymerase II"
/translation="DPEFVAAIRTRDPKLRFKRVWAVCKKKRKCENEDRQDKNKDEEF
APGAKNVVLEGHGGCGNMQPQVRQAALQLKAAFEVTSEEGPKRKETVNISAEMAHGIL
RRISERDLHNMGLNSDYARPEWMIITVLPVPPPPVRPSISMDGTGTGMRNEDDLTYKL
GDIIRANGNVKQAIREGSPQHIARDFEELL"
BASE COUNT 146 a 147 c 158 g 119 t
ORIGIN
1 gatcccgaat tcgttgcagc tattcgtact agagatccga aacttcgatt caagcgcgtc
61 tgggccgtgt gcaagaagaa gcgcaagtgc gagaatgagg accggcaaga caagaacaag
121 gatgaggagt ttgcaccggg cgctaagaac gttgttctcg aaggacacgg cggatgtggc
181 aacatgcagc cgcaagtgag acaagctgcg ctgcaactca aggctgcttt cgaagtcacc
241 tcggaggaag gccccaagag aaaggagacc gtcaatatca gcgccgaaat ggctcatggt
301 atccttcgtc gcatctctga gcgcgatctg cacaatatgg gtctcaactc ggactatgcc
361 cgtcccgagt ggatgatcat caccgttctg cctgtacctc ctcctcctgt gcgtcctagt
421 atttccatgg atggtactgg tactggcatg agaaacgaag acgatttgac ctacaagctt
481 ggcgacatta tccgcgccaa cggcaatgtc aagcaggcaa ttcgtgaagg atcaccgcaa
541 cacattgcgc gcgattttga ggagcttctg
10. Hoạt tính sinh học của của các cao chiết tổng, phân đoạn và chất sạch COD của chủng nấm C. cateniannulata CPA14V
11. Cấu trúc hóa học của chất sạch CC1