Luận án Nghiên cứu đánh giá đa dạng vi sinh vật, sàng lọc, thu nhận và xác định tính chất của cellulase suối nước nóng bình châu, Việt Nam bằng kỹ thuật metagenomics

Binh Chau hot spring located in the Ba Ria – Vung Tau province. This is considered as the second highest temperature hot spring in Vietnam with temperatures ranging from 45°C to 82°C and the pH ranging from 7.5 to 7.7. The metagenome of the Binh Chau hot spring was extracted and sequenced using Illumina technology. A total of approximately 10.4 Gbp of raw data was purified to produce 9.4 Gbp of clean data. Reads were assembled into 51,346 contigs with a total length of 172,103,446 bp. Metagenomic binning resulted in 156,093 ORFs. The microbial community of the Binh Chau hot spring was dominant with bacteria and archaea and consisted 41 phyla, 57 classes, 128 orders, 245 families, 825 genera and 2,250 different species. The dominant bacteria phyla were Proteobacteria, Firmicutes, Cyanobacteria, Bacteroidetes, Planctomycetes and Actinobacteria. The dominant archaea phyla were Thaumarchaeota and Euryarchaeota. Furthermore, functional annotation using available database: nr, Swiss-Prot, CAZy and KEGG revealed dynamic potential of hot spring community in terms of metabolism, environmental information processing, cellular processes and other important aspects. Most abundant CAZy-associated genes in the Binh Chau hot spring metagenome were related to glycosyl transferase families GTs (1,633 ORFs) and glycoside hydrolases families GHs (732 ORFs). In total, we obtained 82 putative cellulase – encoding ORFs. These ORFs were identified and classified within the family of GH1, GH3, GH5, GH6, GH8 and GH94

pdf185 trang | Chia sẻ: tueminh09 | Lượt xem: 1820 | Lượt tải: 1Freedownload
Bạn đang xem trước 20 trang tài liệu Luận án Nghiên cứu đánh giá đa dạng vi sinh vật, sàng lọc, thu nhận và xác định tính chất của cellulase suối nước nóng bình châu, Việt Nam bằng kỹ thuật metagenomics, để xem tài liệu hoàn chỉnh bạn click vào nút DOWNLOAD ở trên
eria and Archaea diversity within the hot springs of Lake Magadi and Little Magadi in Kenya. BMC Microbiology 16(1): 136. 76. Kang I, Kang D, Oh HM, Kim H, Kim HJ, Kang TW, Kim SY and Cho JC (2011) Genome sequence of strain IMCC2047, a novel marine member of the Gammaproteobacteria. J Bacteriol 193(14): 3688-3689. 130 77. Kemp PF and Aller JY (2004) Bacterial diversity in aquatic and other environments: what 16S rDNA libraries can tell us. FEMS Microbiol Ecol 47(2): 161-177. 78. Ketudat Cairns JR and Esen A (2010) Beta-Glucosidases. Cell Mol Life Sci 67(20): 3389-3405. 79. Khalid NA, Rajandas H, Parimannan S, Croft LJ, Loke S, Chong CS, Bruce NC and Yahya A (2019) Insights into microbial community structure and diversity in oil palm waste compost. 3 Biotech 9(10): 364. 80. Kim JO, Park SR, Lim WJ, Ryu SK, Kim MK, An CL, Cho SJ, Park YW, Kim JH and Yun HD (2000) Cloning and characterization of thermostable endoglucanase (Cel8Y) from the hyperthermophilic Aquifex aeolicus VF5. Biochem Biophys Res Commun 279(2): 420-426. 81. Krause L, Diaz NN, Goesmann A, Kelley S, Nattkemper TW, Rohwer F, Edwards RA and Stoye J (2008) Phylogenetic classification of short environmental DNA fragments. Nucleic Acids Res 36(7): 2230-2239. 82. Krisch J, Takó M, Papp T and Vágvölgyi C (2010) Characteristics and potential use of β-glucosidases from Zygomycetes. Current Research; Technology and Education Topics in Applied Microbiology and Microbial Biotechnology, Edition: MICROBIOLOGY BOOK SERIES - Number 2, Publisher: Formatex Research Center, Editors: Méndez-Vilas A.: 891-896. 83. Ku T, Lu P, Chan C, Wang T, Lai S, Lyu P and Hsiao N (2009) Predicting melting temperature directly from protein sequences. Comput Biol Chem 33(6): 445-450. 84. Kumar S, Stecher G, Li M, Knyaz C and Tamura K (2018) MEGA X: Molecular Evolutionary Genetics Analysis across Computing Platforms. Molecular Biology and Evolution 35(6): 1547-1549. 85. Kumar S, Tsai CJ and Nussinov R (2000) Factors enhancing protein thermostability. Protein Eng 13(3): 179-191. 86. Kwon EJ, Jeong YS, Kim YH, Kim SK, Na HB, Kim J, Yun HD and Kim H (2010) Construction of a metagenomic library from compost and screening of 131 cellulase- and xylanase-positive clones. J Korean Soc Appl Biol Chem 53(6): 702-708. 87. Laemmli UK (1970) Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature 227(5259): 680-685. 88. Langmead B and Salzberg SL (2012) Fast gapped-read alignment with Bowtie 2. Nat Methods 9(4): 357-359. 89. Larkin M, Blackshields G, Brown N, Chenna R, McGettigan P, McWilliam H, Valentin F, Wallace I, Wilm A, Lopez R, Thompson J, Gibson T and Higgins D (2007) Clustal W and Clustal X version 2.0. Bioinformatics 23(21): 2947-2948. 90. Le Costaouëc T, Pakarinen A, Várnai A, Puranen T and Viikari L (2013) The role of carbohydrate binding module (CBM) at high substrate consistency: Comparison of Trichoderma reesei and Thermoascus aurantiacus Cel7A (CBHI) and Cel5A (EGII). Bioresour Technol 143: 196-203. 91. Lê Mai Hương (2014-2017). Đề tài: Nghiên cứu metagenome vi sinh vật đất vùng rễ một số đại diện cây trồng ở Việt Nam: cây thuốc có củ (cây nghệ), cây công nghiệp (cà phê, lạc) nhằm tăng năng suất và chất lượng cây trồng. Mã số: ĐTĐLCN. 14/4. 92. Leis B, Heinze S, Angelov A, Pham VT, Thurmer A, Jebbar M, Golyshin PN, Streit WR, Daniel R and Liebl W (2015) Functional Screening of Hydrolytic Activities Reveals an Extremely Thermostable Cellulase from a Deep-Sea Archaeon. Front Bioeng Biotechnol 3: 95. 93. Li W and Godzik A (2006) Cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics 22(13): 1658-1659. 94. Liew KJ, Lim CC, Chan CS, Wei KY, Salleh MM, Sani RK, Chan KG and Goh KM (2018) Chapter 16 - Direct Cellulase Gene Amplification From Hot Spring Using the Guidance of 16S rRNA Amplicon Metagenomics. Metagenomics. M. Nagarajan, Academic Press: 309-325. 95. Lin H, Chen W and Ding H (2013) AcalPred: a sequence-based tool for discriminating between acidic and alkaline enzymes. PLoS One 8(10): e75726. 132 96. Linhult M, Gulich S, Graslund T, Simon A, Karlsson M, Sjoberg A, Nord K and Hober S (2004) Improving the tolerance of a protein a analogue to repeated alkaline exposures using a bypass mutagenesis approach. Proteins 55(2): 407-416. 97. Liu D, Zhang R, Yang X, Zhang Z, Song S, Miao Y and Shen Q (2012) Characterization of a thermostable beta-glucosidase from Aspergillus fumigatus Z5, and its functional expression in Pichia pastoris X33. Microb Cell Fact 11: 25. 98. López-López O, Cerdán ME and González-Siso MI (2013) Hot Spring Metagenomics. Life 3(2): 308-320. 99. Lopez-Mondejar R, Zuhlke D, Becher D, Riedel K and Baldrian P (2016) Cellulose and hemicellulose decomposition by forest soil bacteria proceeds by the action of structurally variable enzymatic systems. Sci Rep 6: 25279. 100. Luo R, Liu B, Xie Y, Li Z, Huang W, Yuan J, He G, Chen Y, Pan Q, Liu Y, Tang J, Wu G, Zhang H, Shi Y, Liu Y, Yu C, Wang B, Lu Y, Han C, Cheung DW, Yiu SM, Peng S, Xiaoqian Z, Liu G, Liao X, Li Y, Yang H, Wang J, Lam TW and Wang J (2012) SOAPdenovo2: an empirically improved memory- efficient short-read de novo assembler. GigaScience 1(1): 18-18. 101. Lý Kim Bảng, Lê Gia Hy, Tăng Thị Chính, Phan Tuyết Minh, Lê Thị Thanh Xuân, Trần Quang Huy, Đào Ngọc Quang and Phạm Thị Cúc (1999). Sử dụng vi sinh vật có hoạt tính phân giải cellulose cao để nâng cao chất lượng phân hủy rác thải sinh hoạt và nông nghiệp. Báo cáo khoa học, Hội nghị Công nghệ Sinh học toàn quốc, Hà Nội, NXB Khoa học và Kỹ thuật. 102. Mahalik S, Sharma A and Mukherjee K (2014) Genome engineering for improved recombinant protein expression in Escherichia coli. Microb Cell Fact 13: 177. 103. Malkawi H and Al-Omari M (2010) Culture-dependent and culture-independent approaches to study the bacterial and archaeal diversity from Jordanian hot springs. Afr J Microbiol Res 4: 923-932. 104. Marchler-Bauer A, Bo Y, Han L, He J, Lanczycki CJ, Lu S, Chitsaz F, Derbyshire MK, Geer RC, Gonzales NR, Gwadz M, Hurwitz DI, Lu F, Marchler 133 GH, Song JS, Thanki N, Wang Z, Yamashita RA, Zhang D, Zheng C, Geer LY and Bryant SH (2017) CDD/SPARCLE: functional classification of proteins via subfamily domain architectures. Nucleic acids research 45(D1): D200-D203. 105. Mardanov AV, Gumerov VM, Beletsky AV, Perevalova AA, Karpov GA, Bonch-Osmolovskaya EA and Ravin NV (2011) Uncultured archaea dominate in the thermal groundwater of Uzon Caldera, Kamchatka. Extremophiles 15(3): 365-372. 106. Marsh CL and Larsen DH (1953) Characterization of some thermophilic bacteria from the Hot Springs of Yellowstone National Park. J Bacteriol 65(2): 193-197. 107. Mehetre GT, Paranjpe AS, Dastager SG and Dharne MS (2015) Complete metagenome sequencing based bacterial diversity and functional insights from basaltic hot spring of Unkeshwar, Maharashtra, India. Genomics data 7: 140-143. 108. Merino N, Aronson HS, Bojanova DP, Feyhl-Buska J, Wong ML, Zhang S and Giovannelli D (2019) Living at the Extremes: Extremophiles and the Limits of Life in a Planetary Context. Frontiers in microbiology 10: 780-780. 109. Miller G (1959) Use of Dinitrosalisylic acid reagent for determination of reducing sugars. Anal Chem 31: 426-428. 110. Miroux B and Walker JE (1996) Over-production of Proteins inEscherichia coli: Mutant Hosts that Allow Synthesis of some Membrane Proteins and Globular Proteins at High Levels. J Mol Biol 260(3): 289-298. 111. Mount DW (2004) Bioinformatics: Sequence and Genome Analysis, Cold Spring Harbor Laboratory Press. 112. Nakagawa S, Shtaih Z, Banta A, Beveridge TJ, Sako Y and Reysenbach AL (2005) Sulfurihydrogenibium yellowstonense sp. nov., an extremely thermophilic, facultatively heterotrophic, sulfur-oxidizing bacterium from Yellowstone National Park, and emended descriptions of the genus Sulfurihydrogenibium, Sulfurihydrogenibium subterraneum and Sulfurihydrogenibium azorense. Int J Syst Evol Microbiol 55(Pt 6): 2263-2268. 134 113. Nam KH, Kim SJ, Kim MY, Kim JH, Yeo YS, Lee CM, Jun HK and Hwang KY (2008) Crystal structure of engineered β-glucosidase from a soil metagenome. Proteins 73(3): 788-793. 114. Neddersen M and Elleuche S (2015) Fast and reliable production, purification and characterization of heat-stable, bifunctional enzyme chimeras. AMB Express 5(1): 33. 115. Nguyễn Kim Thoa và Trần Thanh Thủy (2018). Đặc điểm Carboxymethyl cellulase kiềm của chủng vi khuẩn ưa nhiệt phân lập từ suối nước nóng Bình Châu. Báo cáo Khoa học. Hội nghị Khoa học Công nghệ Sinh học toàn quốc 2018., Trung tâm Hội nghị Quốc gia Hà Nội, 26 tháng 10 năm 2018., Nhà xuất bản Khoa học Tự nhiên và Công nghệ: 1230-1235. 116. Nguyễn Kim Thoa, Trần Thanh Thủy, Trần Thị Hoa và Trần Đình Mấn (2015). Tiềm năng thu nhận enzyme bền nhiệt từ nhóm vi khuẩn phân lập tại suối nước nóng Bình Châu. Báo cáo Khoa học về Sinh thái và Tài nguyên sinh vật. Hội nghị Khoa học toàn quốc về Sinh thái và Tài nguyên sinh vật lần thứ 6: 1234-1238. 117. Nguyễn Kim Thoa, Trần Thị Hoa, Trần Đình Mấn và Tạ Thị Thu Thủy (2017) Nghiên cứu tính chất α-Amylase của các chủng vi khuẩn thuộc chi Geobacillus phân lập ở suối nước nóng Bình Châu. Tạp chí Công nghệ Sinh học 15(2): 373-380. 118. Nguyễn Thị Kim Cúc (2014-2018). Đề tài: “Nghiên cứu metagenome của vi sinh vật liên kết hải miên tại biển miền Trung Việt Nam nhằm phát hiện và sàng lọc các chất hoạt tính sinh học mới”, Mã số: ĐTĐLCN.17/14. 119. Niu C, Zhu L, Xu X and Li Q (2016) Rational Design of Disulfide Bonds Increases Thermostability of a Mesophilic 1,3-1,4-beta-Glucanase from Bacillus terquilensis. PLoS One 11(4): e0154036. 120. Panasik N, Brenchley JE and Farber GK (2000) Distributions of structural features contributing to thermostability in mesophilic and thermophilic alpha/beta barrel glycosyl hydrolases. Biochim Biophys Acta 1543(1): 189-201. 121. Paul S, Cortez Y, Vera N, Villena G and Gutiérrez-Correa M (2016) Metagenomic analysis of microbial community of an Amazonian geothermal spring in Peru. Genomics Data 9. 135 122. Payne CM, Knott BC, Mayes HB, Hansson H, Himmel ME, Sandgren M, Ståhlberg J and Beckham GT (2015) Fungal Cellulases. Chem Rev 115(3): 1308-1448. 123. Pedron R, Esposito A, Bianconi I, Pasolli E, Tett A, Asnicar F, Cristofolini M, Segata N and Jousson O (2019) Genomic and metagenomic insights into the microbial community of a thermal spring. Microbiome 7(1): 8. 124. Pereira J, Giese E, Moretti M, dos Santos AC, Micali Perrone O, Boscolo M, Da Silva R, Gomes E and Martins D (2017) Effect of metal ions, chemical agents and organic compounds on lignocellulolytic enzymes activities. Enzyme Inhibitors and Activators, InTech: 139-164. 125. Perevalova A, Bidzhieva S, Kublanov I, Hinrichs K, Liu X, Mardanov A, Lebedinsky A and Bonch-Osmolovskaya E (2010) Fervidicoccus fontis gen. nov., sp. nov., an anaerobic, thermophilic crenarchaeote from terrestrial hot springs, and proposal of Fervidicoccaceae fam. nov. and Fervidicoccales ord. nov. Int J Syst Bacteriol 60(9): 2082 - 2088. 126. Phạm Công Hoạt, Phùng Thu Nguyệt and Trần Ngọc Hùng (2014) Metagenomics và việc khai thác tiềm năng đa dạng sinh học nguồn gen vi sinh vật của Việt Nam. Tạp chí khoa học công nghệ Việt Nam 21: 6-9. 127. Phan Thị Tuyết Minh, Nguyễn Quốc Việt, Nguyễn Kim Thoa, Lê Gia Hy and Trần Đình Mấn (2016) Thiết kế hệ thống biểu hiện ổn định gen mã hóa endoglucanase trong Bacillus subtilis 168M. Tạp chí Công nghệ Sinh học 14(2): 347-351. 128. Placido A, Hai T, Ferrer M, Chernikova TN, Distaso M, Armstrong D, Yakunin AF, Toshchakov SV, Yakimov MM, Kublanov IV, Golyshina OV, Pesole G, Ceci LR and Golyshin PN (2015) Diversity of hydrolases from hydrothermal vent sediments of the Levante Bay, Vulcano Island (Aeolian archipelago) identified by activity-based metagenomics and biochemical characterization of new esterases and an arabinopyranosidase. Appl Microbiol Biotechnol 99(23): 10031-10046. 136 129. Poidevin L, Feliu J, Doan A, Berrin J, Bey M, Coutinho P, Henrissat B, Record E and Heiss-Blanquet S (2013) Insights into exo- and endoglucanase activities of family 6 glycoside hydrolases from Podospora anserina. Appl Environ Microbiol 79(14): 4220-4229. 130. Posta K, Beki E, Wilson DB, Kukolya J and Hornok L (2004) Cloning, characterization and phylogenetic relationships of cel5B, a new endoglucanase encoding gene from Thermobifida fusca. J Basic Microbiol 44(5): 383-399. 131. Pruitt K, Tatusova T and Maglott D (2007) NCBI reference sequences (RefSeq): a curated non-redundant sequence database of genomes, transcripts and proteins. Nucleic Acids Res 35(Database issue): D61-D65. 132. Qin L, Li WC, Liu L, Zhu JQ, Li X, Li BZ and Yuan YJ (2016) Inhibition of lignin-derived phenolic compounds to cellulase. Biotechnol Biofuels 9(1): 70. 133. Rasheed Z and Rangwala H (2012) Metagenomic taxonomic classification using extreme learning machines. J Bioinform Comput Biol 10(5): 1250015. 134. Rawat R, Kumar S, Chadha B, Kumar D and Oberoi H (2015) An acidothermophilic functionally active novel GH12 family endoglucanase from Aspergillus niger HO: purification, characterization and molecular interaction studies. Antonie Van Leeuwenhoek 107(1): 103-117. 135. Resources YCf (1997). Thermophilic microorganism survey Yellowstone national park. 136. Rhee JK, Ahn DG, Kim YG and Oh JW (2005) New thermophilic and thermostable esterase with sequence similarity to the hormone-sensitive lipase family, cloned from a metagenomic library. Appl Environ Microbiol 71(2): 817-825. 137. Riesenfeld CS, Schloss PD and Handelsman J (2004) Metagenomics: genomic analysis of microbial communities. Annu Rev Genet 38: 525-552. 138. Roehe R, Dewhurst RJ, Duthie CA, Rooke JA, McKain N, Ross DW, Hyslop JJ, Waterhouse A, Freeman TC, Watson M and Wallace RJ (2016) Bovine Host Genetic Variation Influences Rumen Microbial Methane Production with Best 137 Selection Criterion for Low Methane Emitting and Efficiently Feed Converting Hosts Based on Metagenomic Gene Abundance. PLoS Genet 12(2): e1005846. 139. Rothschild L and Mancinelli R (2001) Life in extreme environments. Nature 409: 1092-1101. 140. Roumpeka DD, Wallace RJ, Escalettes F, Fotheringham I and Watson M (2017) A Review of Bioinformatics Tools for Bio-Prospecting from Metagenomic Sequence Data. Front Genet 8. 141. Rozanova EP and Khudiakova AI (1974) A new non-spore forming thermophilic organism, reducing sulfates, Desulfovibrio thermophilus nov. sp. Mikrobiologiia 43: 1069–1075. 142. Russell RJ, Ferguson JM, Hough DW, Danson MJ and Taylor GL (1997) The crystal structure of citrate synthase from the hyperthermophilic archaeon pyrococcus furiosus at 1.9 A resolution. Biochemistry 36(33): 9983-9994. 143. Russell RJM, Gerike U, Danson MJ, Hough DW and Taylor GL (1998) Structural adaptations of the cold-active citrate synthase from an Antarctic bacterium. Structure 6(3): 351-361. 144. Ryan W, Collier P, Loredo L, Pope J and Sachdev R (1996) Growth kinetics of Escherichia coli and expression of a recombinant protein and its isoforms under heat shock conditions. Biotechnol Prog 12(5): 596-601. 145. Sajadi S (2010) Metal ion-binding properties of L-glutamic acid and L-aspartic acid, a comparative investigation. Natural Science 02: 85-90. 146. Sanchez Hernandez JA (2019) Thermal Denaturation and Refolding of Carbohydrate Binding Modules to Improve Enzyme Recycling in a Lignocellulosic Biorefinery. Master, Hood college. 147. Sandgren M (2003). Structural and functional studies of glycoside hydrolase family 12 enzymes from Trichoderma reesei and other cellulolytic microorganisms. Comprehensive Summaries of Uppsala Dissertations from the Faculty of Science and Technology. Uppsala, Acta Universitatis Upsaliensis. 819: 68. 138 148. Sandgren M, Gualfetti P, Shaw A, Gross L, Saldajeno M, Day A, Jones T and Mitchinson C (2003) Comparison of family 12 glycoside hydrolases and recruited substitutions important for thermal stability. Protein Sci 12(4): 848-860. 149. Santos C, Zanphorlin L, Crucello A, Tonoli C, Ruller R, Horta M, Murakami M and de Souza A (2016) Crystal structure and biochemical characterization of the recombinant ThBgl, a GH1 β-glucosidase overexpressed in Trichoderma harzianum under biomass degradation conditions. Biotechnol Biofuels 9. 150. Saxena R, Dhakan D, Mittal P, Waiker P, Chowdhury A, Ghatak A and Sharma V (2017) Metagenomic Analysis of Hot Springs in Central India Reveals Hydrocarbon Degrading Thermophiles and Pathways Essential for Survival in Extreme Environments. Front Microbiol 7: 2123-2123. 151. Schröder C, Eixenberger D, Suleiman M, Schäfers C and Antranikian G (2019) Characterization of an extremely thermo-active archaeal β-glucosidase and its activity towards glucan and mannan in concert with an endoglucanase. Appl Microbiol Biotechnol 103(23): 9505-9514. 152. Schroder C, Elleuche S, Blank S and Antranikian G (2014) Characterization of a heat-active archaeal beta-glucosidase from a hydrothermal spring metagenome. Enzyme Microb Technol 57: 48-54. 153. Sezonov G, Joseleau-Petit D and D'Ari R (2007) Escherichia coli Physiology in Luria-Bertani Broth. J Bacteriol 189(23): 8746-8749. 154. Sharma A, Tewari R, Rana SS, Soni R and Soni SK (2016) Cellulases: Classification, Methods of Determination and Industrial Applications. Appl Biochem Biotechnol 179(8): 1346-1380. 155. Sharma D, Dev K and Sourirajan A (2019) A Report on Metal Enhanced, Solvent Tolerant Endoglucanase from Strict Thermophilic Bacillus sp. PW1 and Bacillus sp. PW2 of North West Himalayas. Biol Forum 11(1): 222-230. 156. Sharma P and Guptasarma P (2017) Endoglucanase activity at a second site in Pyrococcus furiosus triosephosphate isomerase-Promiscuity or compensation for a metabolic handicap? FEBS open bio 7(8): 1126-1143. 139 157. Sharma S and Yazdani SS (2016) Chapter 6 - Diversity of Microbial Cellulase System. New and Future Developments in Microbial Biotechnology and Bioengineering. V. K. Gupta. Amsterdam, Elsevier: 49-64. 158. Shi X, Xie J, Liao S, Wu T, Zhao L, Ding G, Wang Z and Xiao W (2017) High- level expression of recombinant thermostable β-glucosidase in Escherichia coli by regulating acetic acid. Bioresource Technology 241: 795-801. 159. Shirai T, Ishida H, Noda J-i, Yamane T, Ozaki K, Hakamada Y and Ito S (2001) Crystal structure of alkaline cellulase K: insight into the alkaline adaptation of an industrial enzyme. Journal of Molecular Biology 310(5): 1079-1087. 160. Simon C and Daniel R (2011) Metagenomic Analyses: Past and Future Trends. Appl Environ Microbiol 77: 1153-1161. 161. Simon C and Daniel R (2017) Construction of Small-Insert and Large-Insert Metagenomic Libraries. Methods Mol Biol 1539: 1-12. 162. Singh G, Verma AK and Kumar V (2016) Catalytic properties, functional attributes and industrial applications of β-glucosidases. 3 Biotech 6(1): 3-3. 163. Slightom R and Buchan A (2009) Surface Colonization by Marine Roseobacters: Integrating Genotype and Phenotype. Appl Environ Microbiol 75: 6027-6037. 164. Steele HL, Jaeger KE, Daniel R and Streit WR (2009) Advances in recovery of novel biocatalysts from metagenomes. J Mol Microbiol Biotechnol 16(1-2): 25-37. 165. Strobel K, Pfeiffer K, Blanch H and Clark D (2015) Structural insights into the affinity of Cel7A carbohydrate-binding module for lignin. J Biol Chem 290(37): 22818-22826. 166. Studier FW (2005) Protein production by auto-induction in high density shaking cultures. Protein Expr Purif 41(1): 207-234. 167. Studier FW (2014) Stable Expression Clones and Auto-Induction for Protein Production in E. coli. Structural Genomics: General Applications. Y. W. Chen. Totowa, NJ, Humana Press: 17-32. 140 168. Sukharnikov LO, Cantwell BJ, Podar M and Zhulin IB (2011) Cellulases: ambiguous nonhomologous enzymes in a genomic perspective. Trends Biotechnol 29(10): 473-479. 169. Sunagawa S, Coelho LP, Chaffron S, Kultima JR, Labadie K, Salazar G, Djahanschiri B, Zeller G, Mende DR, Alberti A, Cornejo-Castillo FM, Costea PI, Cruaud C, d'Ovidio F, Engelen S, Ferrera I, Gasol JM, Guidi L, Hildebrand F, Kokoszka F, Lepoivre C, Lima-Mendez G, Poulain J, Poulos BT, Royo- Llonch M, Sarmento H, Vieira-Silva S, Dimier C, Picheral M, Searson S, Kandels-Lewis S, Bowler C, de Vargas C, Gorsky G, Grimsley N, Hingamp P, Iudicone D, Jaillon O, Not F, Ogata H, Pesant S, Speich S, Stemmann L, Sullivan MB, Weissenbach J, Wincker P, Karsenti E, Raes J, Acinas SG and Bork P (2015) Ocean plankton. Structure and function of the global ocean microbiome. Science 348(6237): 1261359. 170. Tejirian A and Xu F (2010) Inhibition of Cellulase-Catalyzed Lignocellulosic Hydrolysis by Iron and Oxidative Metal Ions and Complexes. Appl Environ Microbiol 76(23): 7673-7682. 171. Tekere M, Lötter A, Olivier J, Jonker N and Venter S (2011) Metagenomic analysis of bacterial diversity of Siloam hot water spring, Limpopo, South Africa. African Journal of Biotechnology 10: 18005-18012. 172. Thankappan S, Kandasamy S, Joshi B, Sorokina KN, Taran OP and Uthandi S (2018) Bioprospecting thermophilic glycosyl hydrolases, from hot springs of Himachal Pradesh, for biomass valorization. AMB Express 8(1): 168-168. 173. Tiwari R, Nain L, Labrou NE and Shukla P (2018) Bioprospecting of functional cellulases from metagenome for second generation biofuel production: a review. Crit Rev Microbiol 44(2): 244-257. 174. Toyama D, de Morais MAB, Ramos FC, Zanphorlin LM, Tonoli CCC, Balula AF, de Miranda FP, Almeida VM, Marana SR, Ruller R, Murakami MT and Henrique-Silva F (2018) A novel beta-glucosidase isolated from the microbial metagenome of Lake Poraque (Amazon, Brazil). Biochim Biophys Acta Proteins Proteom 1866(4): 569-579. 141 175. Tran KM, Le VTT, Ngo DD, Hoang K, Nguyen PV and TH N (2018) Isolation and optimization of the growth conditions of thermophilic microorganism fromhot springs. The Journal of Agriculture and Development 17(3): 55-60. 176. Trần Ngọc Diễm My and Nguyễn Trọng Nhân (2018) Khảo sát sự hiện diện của vi sinh vật phân giải cellulose trong dạ dày còng Perisesarma eumolpe tại khu vực gãy đổ thuộc rừng ngập mặn Cần Giờ. Tạp chí Phát triển khoa học và công nghệ: chuyên san Khoa học tự nhiên 2(5): 18-25. 177. Trần Văn Vươn, Ngô Thị Vân Kiều, Tạ Thị Hương and Nguyễn Thị Lan Phương (2017) Nghiên cứu các chủng xạ khuẩn và nấm mốc có hoạt tính cellulase ở khu vực tây nam vườn quốc gia Kon Ka Kinh - Gia Lai. Tạp chí Khoa học Xã hội, Nhân văn và Giáo dục 7(2): 24-28. 178. Tribolo S, Berrin J-G, Kroon PA, Czjzek M and Juge N (2007) The Crystal Structure of Human Cytosolic β-Glucosidase Unravels the Substrate Aglycone Specificity of a Family 1 Glycoside Hydrolase. Journal of Molecular Biology 370(5): 964-975. 179. Trịnh Đình Khá (2015) Tinh sạch và nghiên cứu đặc tính của Cellulase tự nhiên và tạo cellulase tái tổ hợp từ nấm sợi tại Việt Nam. Tiến sĩ, Đại học Thái Nguyên. 180. Trương Nam Hải (2011-2012). Sàng lọc các enzyme tham gia vào quá trình phân giải cellulose, hemicellulose bằng kỹ thuật metagenomics. 181. Turner P, Mamo G and Karlsson EN (2007) Potential and utilization of thermophiles and thermostable enzymes in biorefining. Microb Cell Fact 6: 9. 182. Valverde A, Tuffin M and Cowan DA (2012) Biogeography of bacterial communities in hot springs: a focus on the actinobacteria. Extremophiles 16(4): 669-679. 183. Van den Ende FP and Gemerden HV (1993) Sulfide oxidation under oxygen limitation by a thiobacillus thioparus isolated from a marine microbial mat. FEMS Microbiol Ecol 13(1): 69-77. 184. Vassilev K, Turmanova S, Ivanova E and Trifonova V (2013) Catalytic Activity of Amino Acids-Metal Complexes in Oxidation Reactions. J Biomater Nanobiotechnol 4(2): 28-36. 142 185. Veena V, Paramasivan P, Parvatham R, Sivapriyadharsini and Kalaiselvi K (2011) Isolation and characterization of β-glucosidase producing bacteria from different sources. African Journal of Biotechnology 10: 14907-14912. 186. Vincze T, Posfai J and Roberts RJ (2003) NEBcutter: A program to cleave DNA with restriction enzymes. Nucleic acids research 31(13): 3688-3691. 187. Vocadlo DJ and Davies GJ (2008) Mechanistic insights into glycosidase chemistry. Curr Opin Chem Biol 12(5): 539-555. 188. Wallace RJ, Rooke JA, McKain N, Duthie CA, Hyslop JJ, Ross DW, Waterhouse A, Watson M and Roehe R (2015) The rumen microbial metagenome associated with high methane production in cattle. BMC Genomics 16. 189. Wang H, Li H, Shao Z, Liao S, Johnstone L, Rensing C and Wang G (2012) Genome sequence of deep-sea manganese-oxidizing bacterium Marinobacter manganoxydans MnI7-9. J Bacteriol 194(4): 899-900. 190. Wang J, Gao G, Li Y, Yang L, Liang Y, Jin H, Han W, Feng Y and Zhang Z (2015) Cloning, Expression, and Characterization of a Thermophilic Endoglucanase, AcCel12B from Acidothermus cellulolyticus 11B. Int J Mol Sci 16(10): 25080-25095. 191. Wang Q, Trimbur D, Graham R, Warren RAJ and Withers SG (1995) Identification of the Acid/Base Catalyst in Agrobacterium faecalis .beta.- Glucosidase by Kinetic Analysis of Mutants. Biochemistry 34(44): 14554-14562. 192. Waterhouse A, Bertoni M, Bienert S, Studer G, Tauriello G, Gumienny R, Heer FT, de Beer TAP, Rempfer C, Bordoli L, Lepore R and Schwede T (2018) SWISS-MODEL: homology modelling of protein structures and complexes. Nucleic acids research 46(W1): W296-W303. 193. Watson M (2014) Illuminating the future of DNA sequencing. Genome Biol 15(2): 108. 194. Wolińska A (2019) Chapter 2 - Metagenomic Achievements in Microbial Diversity Determination in Croplands: A Review. Microbial Diversity in the Genomic Era. S. Das and H. R. Dash, Academic Press: 15-35. 143 195. Wooley JC, Godzik A and Friedberg I (2010) A primer on metagenomics. PLoS Comput Biol 6(2): e1000667. 196. Yang C, Xia Y, Qu H, Li AD, Liu R, Wang Y and Zhang T (2016) Discovery of new cellulases from the metagenome by a metagenomics-guided strategy. Biotechnol Biofuels 9: 138-138. 197. Yennamalli RM, Rader AJ, Kenny AJ, Wolt JD and Sen TZ (2013) Endoglucanases: insights into thermostability for biofuel applications. Biotechnol Biofuels 6(1): 136. 198. Yennamalli RM, Rader AJ, Wolt JD and Sen TZ (2011) Thermostability in endoglucanases is fold-specific. BMC Struct Biol 11: 10-10. 199. Yin YR, Zhang F, Hu QW, Xian WD, Hozzein WN, Zhou EM, Ming H, Nie GX and Li WJ (2015) Heterologous expression and characterization of a novel halotolerant, thermostable, and alkali-stable GH6 endoglucanase from Thermobifida halotolerans. Biotechnol Lett 37(4): 857-862. 200. Zarafeta D, Kissas D, Sayer C, Gudbergsdottir SR, Ladoukakis E, Isupov MN, Chatziioannou A, Peng X, Littlechild JA, Skretas G and Kolisis FN (2016) Discovery and Characterization of a Thermostable and Highly Halotolerant GH5 Cellulase from an Icelandic Hot Spring Isolate. PloS one 11(1): e0146454- e0146454. 201. Zeng J, Gao X, Dai Z, Tang B and Tang XF (2014) Effects of Metal Ions on Stability and Activity of Hyperthermophilic Pyrolysin and Further Stabilization of This Enzyme by Modification of a Ca2+-Binding Site. Appl Environ Microbiol 80(9): 2763-2772. 202. Zhang L, Fu Q, Li W, Wang B, Yin X, Liu S, Xu Z and Niu Q (2017) Identification and characterization of a novel β-glucosidase via metagenomic analysis of Bursaphelenchus xylophilus and its microbial flora. Scientific reports 7(1): 14850. 203. Zhao C, Chu Y, Li Y, Yang C, Chen Y, Wang X and Liu B (2017) High- throughput pyrosequencing used for the discovery of a novel cellulase from a 144 thermophilic cellulose-degrading microbial consortium. Biotechnol Lett 39(1): 123-131. 204. Zhu W, Lomsadze A and Borodovsky M (2010) Ab initio gene identification in metagenomic sequences. Nucleic Acids Res 38(12): e132-e132. 205. Zouhar J, Vévodová J, Marek J, Damborský J, Su XD and Brzobohatý B (2001) Insights into the functional architecture of the catalytic center of a maize beta- glucosidase Zm-p60.1. Plant Physiol. 127(3): 973-985. PHỤ LỤC Phụ lục 1. Bản đồ giới hạn Vector biểu hiện pET-17b (Novagen) ...................... 1 Phụ lục 2. Trình tự nucleotide và axit amin của gen [denovogenes_18736] mã hóa cho endoglucanase .................................................................. 1 Phụ lục 3. Trình tự nucleotide và axit amin của gen [denovogenes_32768] mã hóa cho β-glucosidase ................................................................... 3 Phụ lục 4. Trình tự enzyme giới hạn .................................................................... 4 Phụ lục 5. Các môi trường sử dụng ...................................................................... 5 Phụ lục 6. Các loại đệm sử dụng .......................................................................... 6 Phụ lục 7. Đường chuẩn BSA .............................................................................. 6 Phụ lục 8. Chuẩn bị thuốc thử Coomassie Brilliant Blue để định lượng protein ....... 7 Phụ lục 9. Điện di protein SDS-PAGE ................................................................ 8 Phụ lục 10. Chỉ tiêu hóa lý của mẫu nước thu nhận từ suối nước nóng Bình Châu .... 9 Phụ lục 11. Kết quả dự đoán tâm hoạt động của denovogenes_18736 ................ 10 Phụ lục 12. So sánh trình tự axit amin domain xúc tác của gen denovogenes_18736 với trình tự axit amin trong mô hình domain xúc tác của 1up3.1.A.. ....................................................................... 11 Phụ lục 13. Kích thước của các axit amin trong mô hình cấu trúc protein của denovogenes_18736.. ........................................................................ 11 Phụ lục 14. Đánh giá tính kỵ nước của các axit amin trong cấu trúc bậc 2 và bậc 4 của denovogenes_18736. ......................................................... 12 Phụ lục 15. Vị trí axit amin phân cực (màu xanh tím) trong cấu trúc protein của denovogenes_18736 ................................................................... 12 Phụ lục 16. Vị trí axit amin Cystein trong cấu trúc bậc 2 và bậc 4 (màu vàng) của denovogenes_18736. .................................................................. 13 Phụ lục 17. Vị trí của proline ở trong cấu trúc bậc 2 và bậc 4 (màu xanh tím) của denovogenes_18736. .................................................................. 13 Phụ lục 18. Vị trí axit amin deletions trong mô hình (màu xanh tím) cấu trúc protein của denovogenes_18736 ....................................................... 14 Phụ lục 19. Vị trí và khả năng tích điện -, + của các axit amin trong cấu trúc protein của denovogenes_18736 ....................................................... 14 Phụ lục 20. Vị trí aliphatic (màu xanh tím) trong cấu trúc protein của denovogenes_18736 .......................................................................... 15 Phụ lục 21. Vị trí aromatic (màu xanh tím) trong cấu trúc protein của denovogenes_18736 .......................................................................... 15 Phụ lục 22. Kết quả dự đoán cầu disulfide giữa các Cy strong cấu trúc của denovogenes_18736 .......................................................................... 16 Phụ lục 23. Vị trí của Ser/Thr (màu xanh tím) trong cấu trúc protein của denovogenes_18736 .......................................................................... 17 Phụ lục 24. Kích thước của các axit amin trong mô hình cấu trúc của denovogenes_32768 .......................................................................... 18 Phụ lục 25. Đánh giá tính kỵ nước của các axit amin trong cấu trúc bậc 2 và bậc 4 của denovogenes_32768. ......................................................... 18 Phụ lục 26. Vị trí axit amin phân cực (màu xanh tím) trong cấu trúc của denovogenes_32768 .......................................................................... 19 Phụ lục 27. Vị trí axit amin Cystein trong cấu trúc bậc 2 và bậc 4 (màu vàng) của denovogenes_32768 ................................................................... 19 Phụ lục 28. Vị trí của Ser/Thr ở trong cấu trúc (màu xanh tím) của denovogenes_32768 .......................................................................... 20 Phụ lục 29. Vị trí của proline (màu xanh tím) trong cấu trúc bậc 2 và bậc 4 của denovogenes_32768 .......................................................................... 20 Phụ lục 30. Vị trí axit amin deletions (màu xanh tím) trong mô hình cấu trúc của denovogenes_32768. .................................................................. 21 Phụ lục 31. Vị trí và khả năng tích điện -, + của các axit amin trong cấu trúc denovogenes_32768. ......................................................................... 21 Phụ lục 32. Vị trí aliphatic (màu xanh tím) trong cấu trúc denovogenes_32768. ......................................................................... 22 Phụ lục 33. Vị trí aromatic (màu xanh tím) trong cấu trúc denovogenes_32768. ......................................................................... 22 Phụ lục 34. So sánh trình tự axit amin domain xúc tác của gen denovogenes_32768 với trình tự axit amin trong mô hình domain xúc tác của 1vff.1.A. ......................................................................... 23 Phụ lục 35. Sự khác biệt về trình tự axit amin giữa denovogenes_32768 (query 23187) và Cen502 (query 23189). .................................................... 23 1 PHỤ LỤC Phụ lục 1. Bản đồ giới hạn vector biểu hiện pET-17b (Novagen) Phụ lục 2. Trình tự nucleotide và axit amin của gen denovogenes_18736 mã hóa cho endoglucanase # 5'3' Frame 1 atgctgccgcaagtagccgaagccgcaactcggaccgagtcggcgaataacacagtgtta M L P Q V A E A A T R T E S A N N T V L gtcgcaggccagaccggatcgattgtcgacgatcgtttgaacgtttggacaatcgtgaac V A G Q T G S I V D D R L N V W T I V N ggcgtcgtgaagaagaacggagcgaacgccgggtacagcgcccgcgtcattcaattggcg G V V K K N G A N A G Y S A R V I Q L A tatgtcaacgatgttgtctggcaggaaaatgccgatcatctttggtggagctggaacggt Y V N D V V W Q E N A D H L W W S W N G 2 agttcatgggacggcggttggggtatcccgaccagcccgttgccgcaaaatgtgtccagt S S W D G G W G I P T S P L P Q N V S S ccgagtaacaacacgtcgctgaccgagtcagccaataactctgtactcctggccggtcaa P S N N T S L T E S A N N S V L L A G Q actggttcactcgtcgaccgccagaaggatgtctggacaattgtaaacggtgtcgtcaaa T G S L V D R Q K D V W T I V N G V V K aagaataacgttagtgccggctacagtgctcgcgttatccagctagcctacgtcaatggt K N N V S A G Y S A R V I Q L A Y V N G gtcatctggcaggaaaatgctgatcatctttggtggagctggaacggtagttcatgggac V I W Q E N A D H L W W S W N G S S W D ggcggttggggtatcccgaccagtccgttgtcgactgctgtaactgctccggcgcctcag G G W G I P T S P L S T A V T A P A P Q ccgcagccagaacctgaaccagcccccgcccccgcaccaacgaatagcagcaacccgttt P Q P E P E P A P A P A P T N S S N P F gctggtcagacactgtaccgcagcagctggtcgaacgcgctcaatcaggccaacgcttgg A G Q T L Y R S S W S N A L N Q A N A W cgttcaacacgaccggacgacgctgccaagatggattacttagccgcccagccgactgcc R S T R P D D A A K M D Y L A A Q P T A cgttggtttggtgactggaatgcgaatattcagagtgatgtcagcgcctacgtaggtgag R W F G D W N A N I Q S D V S A Y V G E gccgctgcagccaatgctctccccgtgcttgtcctctataacatcccgttccgtgactgc A A A A N A L P V L V L Y N I P F R D C ggtagctattctgccggtggtgcgggaagtgcctctggctaccacgactggatcgtgaag G S Y S A G G A G S A S G Y H D W I V K gtggctgaaggtattggtactcgtaaagcgatgatcgtgcttgaaccggatgctacgtcg V A E G I G T R K A M I V L E P D A T S cttgattgtttcgatgatactcgcgcagccatgctggctgacgcagtgaatgtcctcgaa L D C F D D T R A A M L A D A V N V L E gccaagccgaatgtcgctgtctacattgatgctggccacccagactgggttccggctgca A K P N V A V Y I D A G H P D W V P A A actatggccacacgtcttcagaagtctggaattcagaacgctcagggtatggccttgaac T M A T R L Q K S G I Q N A Q G M A L N 3 gtctccaacttctatagcactgactcgaacatggcctacggtaacgacctctcgtcacgt V S N F Y S T D S N M A Y G N D L S S R cttggtggcaagcactacatcatcgacactgcccgcaatcacaacggctggcagggtgag L G G K H Y I I D T A R N H N G W Q G E tggtgtaacccacagggcgctggtatcggtaaggcaccgaccacgaacactggttctgcc W C N P Q G A G I G K A P T T N T G S A ctgttcgatgctggtttgtggatcaagccaccgggagaatccgatggtccgtgtaacggc L F D A G L W I K P P G E S D G P C N G ggtcctggtgctggtagctggtgggcggattacgctctcaagctctacaaccagggcacc G P G A G S W W A D Y A L K L Y N Q G T cactaa H - Phụ lục 3. Trình tự nucleotide và axit amin của gen denovogenes_32768 mã hóa cho β-glucosidase atggaaaagaaatttcctgaaggtttttattggggagcagccacatcctccttccaaacc M E K K F P E G F Y W G A A T S S F Q T gaaggcggcatcgagaacattgattgggcgaagggtgcccgcgaggggagagtgccacca E G G I E N I D W A K G A R E G R V P P ataggaaacgcgtgtgatttttacaatcggtacgaaagcgattttgatattgcgatagaa I G N A C D F Y N R Y E S D F D I A I E ttgggtcacaactgccaccgcatctcaattgaatgggcgcgcattgaaccggaggaaggg L G H N C H R I S I E W A R I E P E E G aagtttgatgaaaaagagatcgaacactatctacaggtactcgccgcgatgcgaaaacgg K F D E K E I E H Y L Q V L A A M R K R cacataaaaccgttcatcacgatctggcatttctcgctcccgcagtggtttgccgacaag H I K P F I T I W H F S L P Q W F A D K ggaggcttcgagcaccgtgattcgccggagattttcgcgcgatactgcggctacgtcgcg G G F E H R D S P E I F A R Y C G Y V A caaaagctcggcaacgactgccgccacttcgcgacgatcaacgaggcgctgccgtacacc Q K L G N D C R H F A T I N E A L P Y T acgaacggctggatccgcggatcgtggccgccctttaaggaggtgcccggactggggtgg 4 T N G W I R G S W P P F K E V P G L G W tcgctctcgcacatccccgggcacatgccaatcaccatggatactcgctggaagaatgtg S L S H I P G H M P I T M D T R W K N V ctcctctatttccgcgtgcgaaaaaatctcgcgcgagcgcacaatcttgcgtatgacgag L L Y F R V R K N L A R A H N L A Y D E atcaaaaagcatgcgttcggcgcggaagtcggcattgtgcatcaaatcattctcttccac I K K H A F G A E V G I V H Q I I L F H gcgaacagtaacccgctcaatcaggcgctcgcggggtgcatgaattggttctggacgcac A N S N P L N Q A L A G C M N W F W T H tccttcattcggcgcgtatatcaaaaatgcgactcgatcggcatcaattactatttgcac S F I R R V Y Q K C D S I G I N Y Y L H aagaaattcggcgacaccgcaacgtaccggaaaaccgacatgaactgggatttttatccg K K F G D T A T Y R K T D M N W D F Y P gaaggcatttgcggagcgctcctcatgatgaagaggtacgggaggccgctgtgggtcgcg E G I C G A L L M M K R Y G R P L W V A gaggctggcatcgccgatgaggacgacgatcagcgcgcggaatacatcacgaagctgatt E A G I A D E D D D Q R A E Y I T K L I catggcatgtggacggcgatccaaagcggcgtcgatctgcgtgggtacatgtactggtcg H G M W T A I Q S G V D L R G Y M Y W S cttctcgataattacgaactcgcacacggctatacaaagcgcttcggcctcgtcgaagtg L L D N Y E L A H G Y T K R F G L V E V aatttcgagacacaagagaggaacatccggccctcggcctatgtttacaagcgcattata N F E T Q E R N I R P S A Y V Y K R I I gagaacaacgggctggtagaatag E N N G L V E - Phụ lục 4. Trình tự enzyme giới hạn 5 Phụ lục 5. Các môi trường sử dụng - Môi trường SOC (g/L) Bacto Tryptone 20 Cao nấm men 5 NaCl 0,5 H2O 980 mL Sau khi khử trùng bổ sung 20 ml dung dịch glucose 1M vô trùng - Môi trường LB (g/L): Bactotryptone 10 Cao nấm men 5 NaCl 5 H2O cất 1000 ml pH 7 - 7,2 - Môi trường NB (g/L) D(+) glucose 1 Cao nấm men 3 Peptone 15 NaCl 6 H2O cất 1000 ml pH 7 - 7,2 - Môi trường TB (g/L) Bacto Tryptone 12 Cao nấm men 24 Glycerin 4 ml H2O cất 900 mL Sau khi khử trùng, bổ sung 100 ml: K2HPO4 0,72 M KH2PO4 0,17 M pH 7 - 7,2 6 Phụ lục 6. Các loại đệm sử dụng Đệm phá tế bào: 50 mM Tris/HCl, pH 8,5 1 mM EDTA 100 mM NaCl 0,1 mM DTE 1 mM PMSF Đệm A 50 mM đệm potassium phosphate, pH 7.4 500 mM natri acetate 10% glycerol 0,1 mM DTE 1% natri cholat 1% Tween 20 0,1 mM PMSF Đệm rửa: Đệm A 10 - 40 mM imidazol Đệm đẩy B: Đệm A 250 mM Imidazole Đệm đẩy C: Đệm A 200 mM Imidazole Phụ lục 7. Đường chuẩn BSA Đồ thị BSA chuẩn được xây dựng ở các nồng độ từ 0–1000 µg/ml. BSA gốc ban đầu được chuẩn bị ở nồng độ 1 mg/ml, sau đó được pha loãng với dung dịch 0,15 M NaCl để tạo thành các thang nồng độ khác nhau với tổng thể tích 1000 l (Bảng 7.1). Đo độ hấp thụ của BSA ở bước sóng 595nm sau 10 phút ở nhiệt độ phòng kể từ khi bổ sung dung dịch màu. Dựng đường chuẩn biểu thị mối liên quan giữa độ hấp thụ của protein ở bước sóng 595 nm và nồng độ BSA (Hình 7.1). Nồng độ protein trong mẫu nghiên cứu được xác định dựa trên đồ thị đường chuẩn BSA. Trộn 100 l mẫu + 900 l dung dịch thuốc thử Coomassie Brilliant Blue. 7 Đo độ hấp thụ protein ở bước sóng 595 nm. Dựa vào hàm số tương quan giữa nồng độ protein và độ hấp thụ để suy ra nồng độ protein trong mẫu. Bảng 7.1: Thành phần phản ứng trong việc xây dựng đường chuẩn BSA Ống nghiệm Thể tích dịch BSA chuẩn nồng độ 1000 µg/ml (µl) Thể tích 0,15 M NaCl (µl) Nồng độ protein tương đương (µg/ml) 1 1000 0 1000 2 500 500 500 3 250 750 250 4 125 875 125 5 100 900 100 6 75 925 75 7 500 từ ống 5 500 50 8 500 từ ống 7 500 25 9 0 1000 0 Hình 7.1: Đồ thị đường chuẩn BSA với phương trình dạng y = ax+b Phụ lục 8. Chuẩn bị thuốc thử Coomassie Brilliant Blue để định lượng protein Hòa 100 mg Coomassie Brilliant Blue G-250 vào 50 ml ethanol có nồng độ 95%. Sau đó tiếp tục bổ sung thêm 100 ml H3PO4 85% (w/v) và dẫn nước tới thể tích 1 lít. Dung dịch cuối cùng có nồng độ các chất (w/v): 0.01% Coomassie Brilliant Blue G-250, 4.7% ethanol và 8.5% H3PO4. y = 0.0075x + 0.084 R² = 0.993 0 0.2 0.4 0.6 0.8 1 1.2 0 25 50 75 100 125 O D 5 9 5 Nồng độ BSA (µg/ml) OD595 Linear (OD595 ) 8 Phụ lục 9. Điện di protein SDS-PAGE Hóa chất đổ gel polyacrylamide-SDS: - Bis- Acrylamide 30% (tỷ lệ acrylamide : bis-acrylamide = 29 : 1). - SDS 0,4%. - APS 10%. - TEMED 100%. - 4x Đệm gel tách: Tris-HCl 1,5M (pH = 8,8); 0,4% SDS - 4x Đệm gel cô: Tris-HCl 0,5M (pH = 6,8); 0,4% SDS -2x SDS đệm tra mẫu (Tris –Hcl 125 mM (pH=6,8), Glycerol 20%, SDS 4%, Bromophenol blue 0,004%, 2-mecaptoethanol 10%. Công thức cho 2 bản gel (gồm gel tách và gel cô) Hóa chất: Gel tách (12%) Gel cô (5%) H2O Đệm 4xgel tách Đệm 4xgel cô Acrylamide 30% APS 10% TEMED 100% 15 ml 3,75 ml 6 ml 75 μl 7,5 μl 10 ml 2,5 ml 1,6 ml 50 μl 5 μl Công thức cho đệm chạy 5X SDS running buffer Tris 15g Glycine 72g SDS 5g Công thức cho dung dịch nhuộm Coomassie Brilliant Blue 0,15% Coomassie Brilliant Blue (CBB) R-250 30% Methanol 10% axit Acetic Công thức cho dung dịch tẩy nhuộm: 30% Methanol và 10% axit Acetic 9 Phụ lục 10. Chỉ tiêu hóa lý của mẫu nước thu nhận từ suối nước nóng Bình Châu TT Chỉ tiêu phân tích Ký hiệu Đơn vị tính Kết quả phân tích 1 Độ đục SiO2 mg/L 1,45 2 Mùi Thối, mặn 3 Cặn không tan mg/L 3,8 4 Cặn sấy khô M mg/L 2,18 5 Độ pH pH 7,5 6 Độ cứng CaO mg/L 259 7 Clorua Cl- mg/L 1,885 8 Nitrate NO3- mg/L 0,4 9 Nitrite NO2- mg/L 0,001 10 Amoni NH4+ mg/L 0,01 11 Hydrosulfua H2S mg/L 0,37 13 Asen As mg/L 0,001 14 Đồng Cu mg/L 0,05 15 Kẽm Zn mg/L 0,04 16 Sắt Fe mg/L 0,05 17 Fluor F mg/L 2,84 18 Iodine I mg/L 0,061 19 Phosphate PO43- mg/L - 20 Sulphate SO42- mg/L 368 21 Mangan Mn mg/L 0,09 22 Magie Mg 7,59 10 Phụ lục 11. Kết quả dự đoán tâm hoạt động của denovogenes_18736 11 Phụ lục 12. So sánh trình tự axit amin domain xúc tác của gen denovogenes_18736 với trình tự axit amin trong mô hình domain xúc tác của 1up3.1.A. Phụ lục 13. Kích thước của các axit amin trong mô hình cấu trúc protein của denovogenes_18736. Chú thích: axit amin có màu xanh lá cây nhạt → đỏ: axit amin có kích thước bé nhất → lớn nhất. 12 Phụ lục 14. Đánh giá tính kỵ nước của các axit amin trong cấu trúc bậc 2 và bậc 4 của denovogenes_18736. Chú thích: axit amin có màu xanh lam→ đỏ: ít kỵ nước → kỵ nước. Phụ lục 15. Vị trí axit amin phân cực (màu xanh tím) trong cấu trúc protein của denovogenes_18736 13 Phụ lục 16. Vị trí axit amin Cystein trong cấu trúc bậc 2 và bậc 4 (màu vàng) của denovogenes_18736. Phụ lục 17. Vị trí của proline ở trong cấu trúc bậc 2 và bậc 4 (màu xanh tím) của denovogenes_18736. 14 Phụ lục 18. Vị trí axit amin deletions trong mô hình (màu xanh tím) cấu trúc protein của denovogenes_18736. Phụ lục 19. Vị trí và khả năng tích điện -, + của các axit amin trong cấu trúc protein của denovogenes_18736 Chú thích: ED màu hồng: tích điện âm; HKR màu xanh tím: tích điện dương 15 Phụ lục 20. Vị trí aliphatic (màu xanh tím) trong cấu trúc protein của denovogenes_18736 Phụ lục 21. Vị trí aromatic (màu xanh tím) trong cấu trúc protein của denovogenes_18736 16 Phụ lục 22. Kết quả dự đoán cầu disulfide giữa các Cys trong cấu trúc của denovogenes_18736 .........10........20........30........40........50........60........70........ AA MLPQVAEAATRTESANNTVLVAGQTGSIVDDRLNVWTIVNGVVKKNGANAGYSARVIQLAYVNDVVWQENADHLWWSWN DB_state DB_conf 80........90........100.......110.......120.......130.......140.......150...... AA GSSWDGGWGIPTSPLPQNVSSPSNNTSLTESANNSVLLAGQTGSLVDRQKDVWTIVNGVVKKNNVSAGYSARVIQLAYV DB_state DB_conf .160.......170.......180.......190.......200.......210.......220.......230..... AA NGVIWQENADHLWWSWNGSSWDGGWGIPTSPLSTAVTAPAPQPQPEPEPAPAPAPTNSSNPFAGQTLYRSSWSNALNQA DB_state DB_conf +---------------- | ..240.......250.......260.......270.......280.......290.......300.......310.... AA NAWRSTRPDDAAKMDYLAAQPTARWFGDWNANIQSDVSAYVGEAAAANALPVLVLYNIPFRDCGSYSAGGAGSASGYHD DB_state 1 DB_conf 4 --------------------------+ | ...320.......330.......340.......350.......360.......370.......380.......390... AA WIVKVAEGIGTRKAMIVLEPDATSLDCFDDTRAAMLADAVNVLEAKPNVAVYIDAGHPDWVPAATMATRLQKSGIQNAQ DB_state 1 DB_conf 3 +-------------------------------- | ....400.......410.......420.......430.......440.......450.......460.......470.. AA GMALNVSNFYSTDSNMAYGNDLSSRLGGKHYIIDTARNHNGWQGEWCNPQGAGIGKAPTTNTGSALFDAGLWIKPPGES DB_state 1 DB_conf 5 ---+ | .....480.......490.......500 AA DGPCNGGPGAGSWWADYALKLYNQGTH 17 DB_state 1 DB_conf 2 DB_bond bond(300,343) DB_bond bond(442,478) Conn_conf 0.913818 Chú thích: AA: Trình tự axit amin; DB_state: dự đoán trạng thái liên kết disulfide (1 = liên kết disulfide, 0 = không có liên kết disulfide); DB_conf: độ tin cậy của dự đoán trạng thái liên kết disulfide (0 = thấp đến 9 = cao); DB_bond: vị trí theo trình tự của một cặp cystein được dự đoán sẽ tạo thành cầu nối disulfide; Conn_conf: độ tin cậy của việc gán kết nối đưa ra ở trạng thái liên kết disulfide được dự đoán (giá trị thực trong [0,1]). Phụ lục 23. Vị trí của Ser/Thr (màu xanh tím) trong cấu trúc protein của denovogenes_18736 18 Phụ lục 24. Kích thước của các axit amin trong mô hình cấu trúc của denovogenes_32768. Chú thích: axit amin có màu xanh lá cây nhạt → đỏ: axit amin có kích thước bé nhất → lớn nhất. Phụ lục 25. Đánh giá tính kỵ nước của các axit amin trong cấu trúc bậc 2 và bậc 4 của denovogenes_32768. Chú thích: axit amin có màu xanh lam→ đỏ: ít kỵ nước → kỵ nước. 19 Phụ lục 26. Vị trí axit amin phân cực (màu xanh tím) trong cấu trúc của denovogenes_32768 Phụ lục 27. Vị trí axit amin Cystein trong cấu trúc bậc 2 và bậc 4 (màu vàng) của denovogenes_32768 20 Phụ lục 28. Vị trí của Ser/Thr ở trong cấu trúc (màu xanh tím) của denovogenes_32768 Phụ lục 29. Vị trí của proline (màu xanh tím) trong cấu trúc bậc 2 và bậc 4 của denovogenes_32768 21 Phụ lục 30. Vị trí axit amin deletions (màu xanh tím) trong mô hình cấu trúc của denovogenes_32768. Phụ lục 31. Vị trí và khả năng tích điện -, + của các axit amin trong cấu trúc denovogenes_32768. Chú thích: ED màu hồng: tích điện âm; HKR màu xanh tím: tích điện dương 22 Phụ lục 32. Vị trí aliphatic (màu xanh tím) trong cấu trúc denovogenes_32768. Phụ lục 33. Vị trí aromatic (màu xanh tím) trong cấu trúc denovogenes_32768. 23 Phụ lục 34. So sánh trình tự axit amin domain xúc tác của gen denovogenes_32768 với trình tự axit amin trong mô hình domain xúc tác của 1vff.1.A. Phụ lục 35. Sự khác biệt về trình tự axit amin giữa denovogenes_32768 (query 23187) và Cen502 (query 23189). Query_23187 1 MEKK--FPEGFYWGAXIT AMIN TSSFQTEGGIENI-----DWAKGAREGRVPPIGNACDFYNRYESDFDIAIELG-----HNCHRI 68 Query_23189 1 MKKLCLLAGVYMWGTATAXIT AMIN LQIEGAKKLCLLVPGGWKTVLDLGDVCPKACVCVQRRQRQCSLRQLSSLPSRYGVHLPTRL 80 Query_23187 69 SI------------EWARIEPEEGKFDEKEIEHYLQVLAXIT AMIN MRKRHI-KPFITIWHFSLPQWFADKGGFEHRDSPEIFARY 135 Query_23189 81 SYISFRGLLATYIPTWCTWSQSRG----IGRIIIVKLI--CLNDNIGLPFSTLYDRVLPQPLQLAVGWGNPPRIQAFVQF 154 Query_23187 136 CGYVAQKLGNDCRHFATINEALP--YTTNGWIRGSWPPFKEVPGLGWSLSHIPGHMPITMDTRWKNVLLYFRVRKNLARA 213 Query_23189 155 AETMFREFHGKIQHWHSFNEPWCTIAFVIQYVNGSCPGSDLSPDCDC-------------------------CRTSSWLA 209 Query_23187 214 HNLAYDEIKKHAFGAEVGIVHQIILFHANSNPLNQALAGCMNWFWTHSFI------------------------------ 263 Query_23189 210 HGLSVRRFRVLGTSGDSGIAPNVSWAVPYWHSEVDKAXIT AMIN CARTISLHSGLFLQPIFQGTIPQFLVDWFALQGGTVPIQDGD 289 Query_23187 264 -RRVYQKCDSIGINYYLHKKFGDTAT------------YRKTDMNWDFYPEGICGALLMMKRYGR-PLWVAEAGIADEDD 329 Query_23189 290 MEYIGEPIDMIGINYYSMSVNRFNPVAPFLQSEEINMPLPLTDIGWPLVARAVYEVLHYLQKYGNIDIYFTENGACYNHE 369 Query_23187 330 ---------DQRAEYITKLIHGMWTAIQSGVDLRGYMYWSLLDNYELAHGYTKRFGLVEVNFETQERNIRPSAYVYKRII 400 Query_23189 370 VVKRAKVQVDRRISKLQQHFQLVQRTIHDRLHVKGYMACSLLDNFLRAEGYKMTFGMIVVDFRTQVRTGLESYYWYGNVL 449 Query_23187 401 ENNGLVE--------- 407 Query_23189 450 SNNWLETRPQSFELLG 465

Các file đính kèm theo tài liệu này:

  • pdfluan_an_nghien_cuu_danh_gia_da_dang_vi_sinh_vat_sang_loc_thu.pdf
  • docx5_Thong tin NCS dua len Web.docx
  • docxTom tat_TTThuy.docx