Luận án Sàng lọc và nghiên cứu ảnh hưởng của đột biến điểm trên peptide tín hiệu đến khả năng tiết α – amylase tái tổ hợp trong bacillus subtilis

Với SP của gen α - amylase D5-2 khi đƣợc thay toàn bộ các axit amin ở vùng H (168MpHVSP12LF14LA15LF17LF21LH22LV24L) bằng L chỉ trừ vị trí G ở tâm kỵ nƣớc đã làm hoạt tính amylase thu đƣợc chỉ đạt 35,9±3,7 U/ml với hàm lƣợng protein tiết tổng số đo đƣợc là 1797,77±21,2 µg/ml và tỷ lệ hoạt tính amylase trên hàm lƣợng protein tiết tổng số của enzyme đạt 19.97 U/mg. Hiệu qua tiết enzyme của chủng tái tổ hợp mang độ biến này chỉ còn 50.8% so với khả năng tiết amylase của chủng gốc mang trình tự SP ban đầu. Tăng độ kỵ nƣớc của vùng H bằng việc thêm L cũng làm tăng biểu hiện alkaline phosphatase ở E. coli (Izard et al., 1996) và Interlleukin - 2 ở B. brevis tuy hiệu qủa tăng tiết enzyme là không nhiều nhƣng đã cho thấy có tác dụng tích cực trong việc cải thiện hoạt tính enzyme tiết bằng việc biến đổi tâm kỵ nƣớc H của SP của gen đích (Takimura et al., 1997).

pdf181 trang | Chia sẻ: tueminh09 | Lượt xem: 1217 | Lượt tải: 1Freedownload
Bạn đang xem trước 20 trang tài liệu Luận án Sàng lọc và nghiên cứu ảnh hưởng của đột biến điểm trên peptide tín hiệu đến khả năng tiết α – amylase tái tổ hợp trong bacillus subtilis, để xem tài liệu hoàn chỉnh bạn click vào nút DOWNLOAD ở trên
Secretion by Bacillus subtilis. World’s largest Science, Technology & Medicine Open Access book publisher: 288. 68. KiroMojsov (2012) Microbial α-amylase and their inductrial applycations: A review. International J. of Management, IT and Engineering 2: 583–609. 69. Kolkman MB, van der Ploeg R, Bertels M, van Dijk M, van der Laan J, van Dijl J.M, Ferrari E (2008) The twin-arginine signal peptide of Bacillus subtilis YwbN can direct either Tat- or Sec-dependent secretion of different cargo proteins: secretion of active subtilisin via the B. subtilis Tat pathway. Applied and environmental microbiology 74: 7507–7513. 70. Kuddus R, Saima M (2013) Cold-active detergent-stable extracellular α-amylase from Bacillus cereus GA6: Biochemical characteristics and its perspectives in laundry detergent formulation. J. Biochem. Tech 4: 636–644. 71. Kundu AK, Das S, Gupta TK (1973) Influence of culture and nurtitional conditions on the production of amylase by the submerged culture of Aspergillus oryzae. J. Ferment. Technol. 51:142–150 72. Landry TD, Chew L, Davis JW, Frawley N, Foley HH, Stelman SJ, Thomas J, Wolt J, Hanselman DS (2003) Safety evaluation of an α-amylase enzyme preparation derived from the archaeal order Thermococcales as expressed in Pseudomonas fluorescens biovar I. Regulatory Toxicology and Pharmacology 37: 149–168. 73. Laskin A, Sariaslani I, Dundee S, Gadd GM (2007) Advances in Applied Microbiology. Academic Press. 74. Lee JW, Kang DO, Kim BY, Oh WK, Mheen TI, Pyun YR, Ahn JS (2000) Mutagenesis of the glucoamylase signal peptide of Saccharomyces diastaticus and functional analysis in Saccharomyces cerevisiae. FEMS Microbiology Letters 193: 7–11. 75. Leite KC (2011) Construction of an efficient secretion system for recombinant proteins in B. subtilis. Doktors der Naturwissenschaften. Universität Bayreuth. 76. Lemberg MK, Martoglio B (2002) Requirements for signal peptide peptidase- catalyzed intramembrane proteolysis. Molecular. Cell. 10: 735–744. 77. Li W, Zhou X, Lu P (2004) Bottlenecks in the expression and secretion of heterologous proteins in Bacillus subtilis. Res. in Microbiol. 155: 605–610. 139 78. Ling Lin Fu, Zi Rong Xu, Wei Fen Li, Jiang Bing Shuai, Ping Lu, Chun Xia Hu (2007) Protein secretion pathways in Bacillus subtilis: Implication for optimization of heterologous protein secretion. Biotechnol. Adv. 25: 1–12. 79. Liu H, Naismith JH (2008) An efficient one-step site-directed deletion, insertion, single and multiple-site plasmid mutagenesis protocol. BMC Biotechnol. 8: 91-101. 80. Le Loir Y, Nouaille S, Commissaire J, Brétigny L, Langella P (2001) Signal Peptide and Propeptide Optimization for Heterologous Protein Secretion in Lactococcus lactis. Appl. and Environ. Microbiol. 67: 4119–4127. 81. Low KO, Jonet MA, Ismail NF, Illias RM (2012), Optimization of a Bacillus sp signal peptide for improved recombinant protein secretion and cell viability in Escherichia coli: Is there an optimal signal peptide design?. Bioengineered, 3: 334– 338. 82. Low KO, Mahadi NM, Illias RM (2013),.Optimization of signal peptide for recombinant protein secretion in bacterial hosts. Applied Microbiology and Biotechnology 97: 3811–3826. 83. Lowry OH, Rosebrough NJ, Farr AL, Randall RJ (1951) Protein measurement with the Folin Phenol Reagent. J. Biol. Chem 193: 265–275. 84. Ma Y, Shen W, Chen X, Liu L, Zhou Z, Xu F,Yang H (2016) Significantly enhancing recombinant alkaline amylase production in Bacillus subtilis by integration of a novel mutagenesis-screening strategy with systems-level fermentation optimization. Journal of Biological Engineering 10: 13 - 24. 85. Maarel V. Der, Der B. Van, Joost CM (2002) Properties and applications of starch- converting enzymes of the α -amylase family. J. of Biotechnology 94: 137–155. 86. Macauley-Patrick S, Fazenda ML, McNeil B, Harvey LM (2005), Heterologous protein production using the Pichia pastoris expression system, Yeast, 22: 249–270. 87. MacGregora EA, Janečekb Š, Svensson B (2001), Relationship of sequence and structure to specificity in the α-amylase family of enzymes. Biochimica et Biophysica Acta (BBA) - Protein Structure and Molec. Enzymol., 1546: 1–20. 88. Ngô Xuân Mạnh, Nguyễn Thị Lâm Đoàn, Võ Nhân Hậu, Ngô Xuân Dũng (2008), chọn lựa điều kiện nuôi cấy tối ƣu vi khuẩn B. licheniformis (chủng BCRP) để sinh tổng hợp alpha amylase chịu nhiệt. TC Khoa học và Phát triển, 5: 460–466. 89. Mahmood S, Rahman SR (2008), Production and partial characterization of extracellular α-amylase by Trichoderma viride. Bangladesh J Microbiol., 25(2):99– 103 140 90. Mansour A, Zeinab R, Amanollah ZA (2015), Research Article Isolation and Identification of Bacillus Species From Soil and Evaluation of Their Antibacterial Properties. Avicenna. J. Clin. Microb. Infec. 2(1): e23233. DOI: 10.17795/ajcmi- 23233 91. Mathiesen G, Sveen A, Brurberg MB, Fredriksen L, Axelsson L, Eijsink VG (2009) Genome-wide analysis of signal peptide functionality in Lactobacillus plantarum WCFS1. BMC Genom, 10. 92. Mathew CD and Rathnayake S (2014) Isolation and characterization of alpha amylase isolated from a hot water spring in Sri Lanka. International Research Journal of Microbiology (IRJM) 5(4): 50-61. 93. Trần Đình Mấn (2001) Nghiên cứu thu nhận α-amylase bền nhiệt bằng chủng Bacillus subtilis tái tổ hợp mang gen α-amylase của vi khuẩn phân lập ở Việt Nam. Luận án tiến sĩ, Đại học Bách Khoa Hà Nội. 94. Trần Đình Mấn, Nguyễn Kim Thoa, Lƣơng Đức Phẩm, Lê Văn Nhƣơng (2004) Ảnh hƣởng của một số yếu tố đến khả năng sinh tổng hợp alpha-amylaza chịu nhiệt của chủng tái tổ hợp Bs168M{pHV33-BL.Amy.BSpr}. KH&CN 42: 7–12. 95. Trần Đình Mấn, Nguyễn Thế Trang Nguyễn Kim Thoa, Nguyễn Quốc Việt, Nguyễn Thị Đà, Trần Thị Hoa, Lại Thị Hồng Nhung (2011) Đặc điểm sinh học của một số chủng ƣa nhiệt phân lập ở suối nƣớc nóng Mỹ Lâm – Tuyên quang, Hội Nghị khoa học toàn quốc lần thứ 4 về Sinh thái và Tài nguyên sinh vật: 1713 – 1719 96. Trần Đình Mấn, Schweder T. (1999) Khả năng sinh tổng hợp và đặc điểm alpha- amylaza chịu nhiệt của chủng vi khuẩn 3BT2. Tuyển tập báo cáo khoa học Hội nghị CNSH toàn quốc: 592–598. 97. Meima R, van Dijl JM. (2003) Protein Secretion in Gram - Positive Bacteria, In Protein Secretion Pathways in Bacteria, Ed B. Oudega. Springer-science and Business media, B.V. 98. Mergulhão FJM, Summers DK, Monteiro G (2005) Recombinant protein secretion in Escherichia coli. Biotechnology advances 23: 177–202. 99. Miller GL (1959) Use of DinitrosaIicyIic Acid Reagent for Determination of Reducing Sugar. Analytical chemistry 31: 426–428. 100. Ming YM, Wei ZW, Lin CY, Sheng GY (2010) Development of a Bacillus subtilis expression system using the improved Pglv promoter. Microbial cell factories 9 (55): 1-8. 141 101. Mobini-dehkordi M, Javan FA (2012) Review Article: Application of alpha- amylase in biotechnology. Journal of Biology and today’s world 1: 39–50. 102. Monroy-Lagos O, Soberon X, Gaytan P, Osuna J (2006) Improvement of an unusual twin-arginine transporter leader peptide by a codon-based randomization approach. Appl. and Environ. Microbiology 72: 3797–3801. 103. Morrow K (2007) Improving protein production processes. Gen. Eng. News 27: 41– 50. 104. Muraki S, Nishimoto H, Toyama Y, Shimamoto E, Takenaka S, Kaulpiboon J, Prousoontorn M, Limpaseni T, Pongsawasdi P, Aoki K. (2007) Purification and Characterization of Two Alkaline, Thermotolerant α-Amylases from Bacillus halodurans 38C-2-1 and Expression of the Cloned Gene in E. coli. Bioscience, Biotechnology and Biochemistry 71: 2393–2401. 105. Naidu MA (2013) Bacterial Amylase A Review. International Journal of Pharmaceutical & Biological Archive 4: 274–287. 106. Nakajima R, Imanaka T, Aiba S (1985) Nucleotide Sequence of the Bacillus stearothermophilus.Journal of Bacteriology 163(1): 401-406. 107. Nakamura K, Fujita Y, Itoh Y, Yamane K (1989) Modification of length, hydrophobic properties and electric charge of Bacillus subtilis alpha-amylase signal peptide and their different effects on the production of secretory proteins in B. subtilis and Escherichia coli cells. Mol. Gen. Genet 216: 1–9. 108. Nakamura K, Takase K (1990) Artificial insertion of peptides between signal peptide and mature protein: effect on secretion and processing of hybrid thermostable a-amylases in Bacillus subtilis and Escherichia coli cells.Journal of General Microbiology 136: 1551-1558. 109. Naturwissenschaften D. Der (2010) Genetic tools for high yield protein production with Bacillus megaterium. Lebenswissenschaften, PhD. 110. Naturwissenschaften D Der (2007) Production and secretion of recombinant proteins using Bacillus megaterium.Doktorin der Naturwissenschaften. Von der Fakultät für Lebenswissenschaften der Technischen Universität Carolo-Wilhelmina 111. Nguyen Q.D (2003) Studies on some carbohydrolases with nutrition potential. PhD school of food science, Szent István University. 112. Nielsen H, Engelbrecht J, Brunak S, von Heijne G (1997a) A neural network method for identification of prokaryotic and eukaryotic signal peptides and prediction of their cleavage sites. Int. J. Neural. Syst. 8:581–599 142 113. Nielsen H, Engelbrecht J, Søren B, von Heijne G (1997b) Identification of prokaryotic and eukaryotic signal peptides and prediction of their cleavage sites Artificial neural networks have been used for many biological. Protein Engineering 10: 1–6. 114. Nijland R, Kuipers O (2008) Optimization of Protein Secretion by Bacillus subtilis. Recent Patents on Biotechnology, 2, 79–87. 115. Niu D, Zuo Z, Shi GY, Wang, ZX (2009) High yield recombinant thermostable α- amylase production using an improved B. licheniformis system. Microbial Cell Factories 8: 58-65. 116. Nunes De Souza A, Lelis M, Martins L (2001), Isolation, Properties and Kinetics of Growth of a Thermophilic Bacillus. Brazilian J. of Microbiology 32: 271–275. 117. Nusrat A, Rahman SR (2007), Comparative Studies on the Production of Extracellular α-Amylase by Three Mesophilic Bacillus Isolates. Bangladesh J. Microbiol. 24: 129–132. 118. Olagoke OA (2014) Mycelial growth and cellulase activities of some thermophilic fungi isolated from municipal solid wastes and palm-kernel stacks in Nigeria. American Journal of Microbiology and Biotechnology, 1 (1): 27–35. 119. Padayachee T (2006), Application of Thermostable α-amylase from Thermomyces lanuginosus ATCC 58157 to nutritionally enhance starch based food. Doctorate of Technology (Biotechnology). Department of Biotechnology, Durban University of Technology. 120. Pagé N, Kluepfel D, Shareck F, Morosoli R (1996) Effect of signal peptide alterations and replacement on export of xylanase A in Streptomyces lividans. Applied and Environmental Microbiology, 62: 109–114. 121. Pandey A, Nigam P, Soccol C.R, Soccol V.T, Singh D, Mohan R (2000) Advances in microbial amylases. Biotechnol. Appl. Biochem., 31, 135–152. 122. Parmar D, Pandya A (2012) Characterization of Amylase Producing Bacterial Isolates. Bull. Environ. Pharmacol. Life Sci., 1: 42–47. 123. Patcharaporn B, Chotima P, Julian GH and Rasana WS (2017), Secondary metabolites from Bacillus amyloliquefaciens isolated from soil can kill Burkholderia pseudomallei. AMB Express. 7: 16. Published online 124. Pechsrichuang P, Songsiriritthigul C, Haltrich D, Roytrakul S, Namvijtr P, Bonaparte N, Yamabhai M. (2016), OmpA signal peptide leads to heterogenous 143 secretion of B. subtilis chitosanase enzyme from E. coli expression system. Springer Plus, 5: 1200–1210. 125. Petersohn A, Bernhardt J, Gerth U, Höper D, Koburger T, Völker U, Hecker M, Bernhardt RG, Gerth ULF (1999) Identification of B -Dependent Genes in Bacillus subtilis Using a Promoter Consensus-Directed Search and Oligonucleotide Hybridization Identification of B -Dependent Genes in Bacillus subtilis Using a Promoter Consensus-Directed Search and Oligonucleo. J .Bacteriol. 181: 5718– 5724. 126. Phan Thi PT, Tran LT, Schumann W, Nguyen HD (2015), Development of P grac 100-based expression vectors allowing high protein production levels in Bacillus subtilis and relatively low basal expression in Escherichia coli. Microbial. Cell Factories, 14: 1–9. 127. Phan TTP, Nguyen H D, Schumann W (2012), Development of a strongintracellular expression system for Bacillus subtilis by optimizing promoter elements. J. Biotechnol., 157(1): 167-172. 128. Priyadharshini R, Manoharan S, Hemalatha D, Gunasekaran P (2010), Repeated random mutagenesis of α-amylase from Bacillus licheniformis for improved pH performance. J. of Microbiol. and Biotechnol.,20: 1696–1701. 129. Pohl S, Harwood CR (2010), Heterologous protein secretion by Bacillus species from the cradle to the grave. Adv. Appl. Microbiol., 73:1–25 130. Qi Y, Kobayashi Y, Hulett FM (1997), The pst operon of Bacillus subtilis has a phosphate-regulated promoter and is involved in phosphate transport but not in regulation of the Pho regulon. Journal of Bacteriology, 179: 2534–2539. 131. Rabbani M, Sadeghi HM , Moazen F, Rahimi M, and Salehi G (2011) Cloning and Expression of Randomly Mutated Bacillus subtilis-Amylase Genes in HB101. Biotechnology Research International: 1-6. 132. Ramachandran N (2005) Development of improved α -amylases. Doctoral degree. Sciences at Stellenbosch. 133. Ray RR (2015) Microbial Avicelase : an Overview. Bull. Env.Pharmacol. Life Sci., 4: 3–13. 134. Reddy NS, Nimmagadda A, Rao KRSS, Nagar N (2003), An overview of the microbial α-amylase family. Afr. J. of Biotechnol., 2 (12): 645–648. 135. Rey MW, Ramaiya P, Nelson B. a, Brody-Karpin SD, Zaretsky EJ, Tang M, Lopez de Leon A, Xiang H, Gusti V, Clausen IG, Olsen PB, Rasmussen MD, Andersen 144 JT, Jørgensen PL, Larsen TS, Sorokin A, Bolotin A, Lapidus A, Galleron N, Ehrlich SD, Berka RM (2004) Complete genome sequence of the industrial bacterium Bacillus licheniformis and comparisons with closely related Bacillus species. Genome Biology, 5 (10): 77-99. 136. Rivera MH, López-Munguía A, Soberón X, Saab-Rincón G (2003), Alpha-amylase from Bacillus licheniformis mutants near to the catalytic site: effects on hydrolytic and transglycosylation activity. Protein engineer. 16: 505–514. 137. van Roosmalen ML, Geukens N, Jongbloed JDH, Tjalsma H, Dubois JYF, Bron S, van Dijl JM, Anné J. (2004) Type I signal peptidases of Gram-positive bacteria. Biochimica et Biophysica Acta 1694: 279–297. 138. Sadeghi, H. M. M., Rabbani, M., Rismani, E., Moazen, F., Khodabakhsh, F., Dormiani K, & Khazaei, Y (2011) Optimization of the expression of reteplase in Escherichia coli. Research in Pharmaceutical Sciences. 6(2). 87–92. 139. Saengkerdsub S, Liyanage R, Oliver J (2013), Suitability of Various Prepeptides and Prepropeptides for the Production and Secretion of Heterologous Proteins by Bacillus megaterium or Bacillus licheniformis. Agriculture, Food and Analytical Bacteriology 3: 230-248 140. Sahukhan R, Roy SK, SLC (1993) Immobilization of α-amylase from Myceliophthora thermophila D-14 (ATCC 48104). Enzyme and Microbial. Technology. 15: 801–804. 141. Sakakibara Y, Tsutsumi K, Nakamura K (1993), Structural requirements of Bacillus subtilis alpha-amylase signal peptide for efficient processing : in vivo pulse-chase experiments with mutant signal peptides. Structural Requirements of Bacillus subtilis α-Amylase Signal Peptide for Efficient Process. J Bacteriol 175 (13): 4203– 4212. 142. Sambrook J, Russell DW (2001) Molecular cloning: a Laboratory Manual. Cold Spring Harbor: Cold Spring Harbor Laboratory Press. 143. Sambrook J, Russell DW(2006) Rapid and Efficient Site-directed Mutagenesis by the Single-tube Megaprimer PCR Method. Cold Spring Harbor Protocols 3467. 144. Sathya TA, Mahejibin K (2014) Diversity of glycosyl hydrolase enzymes from metagenome and their application in food industry. J. Food Sci., 79: 2149–2156. 145. Schallmey M, Singh A, Ward OP (2004) Developments in the use of Bacillus species for industrial production. Can. J. Microbiol., 50(1):1-17. 145 146. Schmeisser C, Steele H, Streit WR (2007), Metagenomics, biotechnology with non- culturable microbes. Appl. Microbiol. and Biotechnol., 75: 955–962. 147. Schneider TD, Stephens RM (1990), Sequence logos: a new way to display consensus sequences. Nucleic Acids Res. 18: 6097–6100. 148. Sevillano L, Vijgenboom E, van Wezel GP, Díaz M, Santamaría RI (2016), New approaches to achieve high level enzyme production in Streptomyces lividans. Microbial Cell Factories 15: 28-38. 149. Sharma A, Satyanarayana T (2013), Microbial acid-stable α-amylases: Characteristics, genetic engineering and applications. Process Biochemistry 48: 201–211. 150. Sharma N, Vamil R, Ahmad S, Agarwal R. (2012), Effect of different carbon and nitrogen sources on α-amylase production from Bacillius amyloliquefaciens. Int J Pharm Sci Res.,3 (4):1161–1163. 151. Simair AA, Qureshi AS, Khushk I, Ali CH, Lashari S, Bhutto MA, Lu C (2017)Production and partial characterization of α-amylase enzyme from Bacillus sp. BCC 01-50 and potential applications. BioMed Research International, 9173040. 152. Simonen M, Palva I (1993), Protein secretion in Bacillus species. Microbiological reviews 57: 109–137. 153. Sivaramakrishnan S, Gangadharan D, Madhavan K, Soccol CR, Pandey A (2006) α- Amylases from Microbial Sources – An Overview on Recent Developments. Food Technol. Biotechnol., 44: 173–184. 154. Society A (1993), Structural Requirements of Bacillus subtilis α-Amylase Signal Peptide for Efficient Processing : In Vivo Pulse-Chase Experiments with Mutant Signal Peptides.J. Bacteriol. 175: 4203–4212. 155. Song Y, Nikoloff JM, Zhang D (2015), Improving protein production on the level of regulation of both expression and secretion pathways in Bacillus subtilis. Journal of Microbiology and Biotechnology. 25: 963–977. 156. Southgate VJ, Steyn AJC, Pretorius IS, van Vuuren HJJ (1993), Expression and Secretion of Bacillus amyloliquefaciens α-Amylase by Using the Yeast Pheromone CL-Factor Promoter and Leader Sequence in Saccharomyces cerevisiae. Appl. Environ. Microbiol. 59 (4): 1253–1258. 157. Souza PM de, Magalhães P de O (2010), Application of microbial α-amylase in industry - a review. Brazilian J. of Microbiology, 41: 850–861. 146 158. Stephens MA, Ortlepp SA, Ollington JF, McConnell DJ (1984), Nucleotide sequence of the 5’ region of the Bacillus licheniformis α-amylase gene: Comparison with the B. amyloliquefaciens gene. J. of Bacteriology158: 369–372. 159. Stephenson K, Carter NM, Y CRH (1998) The influence of protein folding on late stages of the secretion of K-amylases from Bacillus subtilis. FEBS Letters 430: 385–389. 160. Sundarram A, Murthy T.P.K (2014) α -Amylase Production and Applications : A Review. Journal of Appl.& Env. Microbiology 2: 166–175. 161. Suominen L, Meyer P, Tilgmann C, Glumoff T, Glumoff V, Kapyla J, Mantsalal P. (1990) Bacillus stearothermophilus. Microbiology 69: 154–158. 162. Swain MR, Kar S, Padmaja G, Ray RC (2006) Partial characterization and optimization of production of extracellular α-amylase from Bacillus subtilis isolated from culturable cow dung microflora. Pol. J. Microbiol. 55 (4): 289–296 163. Tachibana Y,Leclere MM, Fujiwara S, Takagi M (1996) Cloning and expression of the alpha-amylase gene from the hyperthermophilic archaeon Pyrococcus sp. KOD1, and characterization of the enzyme. Journal of Fermentation and Bioengineering 82: 224–232. 164. Takata H, Kurikis T, Okadas S, Takesadall Y, Minamiurall N, Imanaka T (1992) Action of Neopullulanase. J. of Biological.Chem 267: 18447–18452. 165. Takimura Y, Kato M, Ohta T (1997) Secretion of human interleukin-2 in biologically active form by Bacillus brevis directly into cultute medium. Bioscience, Biotechnology, and Biochemistry 61: 1858–1861. 166. Terpe K (2006) Overview of bacterial expression systems for heterologous protein production: From molecular and biochemical fundamentals to commercial systems. Applied Microbiology and Biotechnology 72: 211–222. 167. Huỳnh Kiều Thanh, Phan Thị Phƣợng Trang, Trần Linh Thƣớc, Nguyễn Đức Hoàng (2014) Sử dụng promoter mạnh Pgrac212 để tăng cƣờng sự biểu hiện tiết alpha amylase chỉ thị ở Bacillus subtilis. Tạp chí Sinh học 36: 90–96. 168. Tjalsma H, Antelmann H, Jongbloed JDH, Braun PG, Darmon E, Dorenbos R, Dubois F, Westers H, Zanen G, Quax WJ, Kuipers OP, Bron S, Hecker M, Dubois JF, Dijl JM (2004) Proteomics of Protein Secretion by Bacillus subtilis : Separating the Secrets of the Secretome Proteomics of Protein Secretion by Bacillus subtilis. Microbiol. Mol. Biol. Rev 68: 207–233. 147 169. Tjalsma H, Bolhuis A, Jongbloed J.D., Bron S,van Dijl JM (2000a) Signal peptide- dependent protein transport in Bacillus subtilis: a genome-based survey of the secretome. Microb. and Molec.Biology Reviews 64: 515–547. 170. Tjalsma H, Noback MA, Bron S, Venema G, Yamane K,van Dijl JM (1997) Bacillus subtilis Contains Four Closely Related Type I Signal Peptidases with Overlapping Substrate Specificities. J. Biol. Chem. 272 (41): 25983–25992. 171. Tutino M.L, Parrilli E, Giaquinto L, Duilio A, Sannia G, Feller G, Marino G, Ii F, Universitario C (2002) Secretion of α- amylase from Pseudoalteromonas haloplanktis TAB23 : Two Different Pathways in Different Hosts. J.Bacteriol. 184 (20): 5814–5817. 172. Lê Văn Trƣờng, Nguyễn Thanh Thủy, Trƣơng Nam Hải (1995) Biến nạp các gen amylaza vào nấm men S. cerevisiae. Kỷ yếu Viện CNSH: 25–32. 173. Vavrová Ľ, Muchová K, Barák I (2010) Comparison of different Bacillus subtilis expression systems. Research in Microbiology 161: 791–797. 174. Vester JK, Glaring MA, Stougaard P (2014) Discovery of novel enzymes with industrial potential from a cold and alkaline environment by a combination of functional metagenomics and culturing. Microb Cell Fact13 (72): 1–14. 175. Vitikainen M (2004) PrsA Lipoprotein and postranslocational folding of secretory proteins in Bacillus subtilis. The National Public Health Institute. Julkaisija- Utgivare-Publisher. 176. Vitikainen M, Lappalainen I, Seppala R, Antelmann H, Boer H, Taira S, Savilahti H, Hecker M, Vihinen M, Sarvas M, Kontinen VP (2004) Structure-function analysis of prsa reveals roles for the parvulin-like and flanking N- and C-terminal domains in protein folding and secretion in Bacillus subtilis. Journal of Biological Chemistry 279: 19302–19314. 177. Voskuil MI, Chambliss GH (1993) Rapid isolation and sequencing of purified plasmid DNA from Bacillus subtilis. Appl Environ Microbiol 59 (4): 1138–1142. 178. Wanderley KJ, Torres FAG, Moraes LMP, Ulhoa CJ (2004) Biochemical characterization of alpha-amylase from the yeast Cryptococcus flavus. FEMS Microbiology Letters 231: 165–169. 179. Wang G, Xia Y, Song X, Ai L (2016a) Common non-classically secreted bacterial proteins with experimental evidence. Curr. Microbiol.72: 102–111. 148 180. Wang P, Wang P, Tian J, Yu X, Chang M, Chu X, Wu N (2016b) A new strategy to express the extracellular α-amylase from Pyrococcus furiosus in Bacillus amyloliquefaciens. Scientific Reports 6: 22229-22239. 181. Watanabe K, Tsuchida Y, Okibe N, Teramoto H, Suzuki N, Inui M, Yukawa H (2009) Scanning the Corynebacterium glutamicum R genome for high-efficiency secretion signal sequences. Microbiology 155:741–750. 182. van Wely KH, Swaving J, Freudl R, Driessen J (2001) Translocation of proteins across the cell envelope of Gram-positive bacteria. FEMS Microbiology Reviews 25: 437–454. 183. Westers H, Darmon E, Zanen G, Veening JW, Kuipers OP, Bron S, Quax WJ, Van Dijl JM (2004) The Bacillus secretion stress response is an indicator for α-amylase production levels. Lett. in Appl. Microbiol 39: 65–73. 184. Wipat A, Harwood CR (1999) The Bacillus subtilis genome sequence: the molecular blueprint of a soil bacterium. FEMS Microbiology Ecology 28: 1–9. 185. Worthington P, Hoang V, Perez-pomares F, Blum P (2003) Targeted Disruption of the alpha-Amylase Gene in the Hyperthermophilic Archaeon Sulfolobus solfataricus. Journal of Bacteriology 185: 482–488. 186. Xie F, Quan S, Liu D, Ma H, Li F, Zhou F, Chen G (2014) Purification and characterization of a novel α-amylase from a newly isolated Bacillus methylotrophicus strain P11-2. Process Biochemistry 49: 47–53. 187. Xavier AREO, Lima ER, Oliveira AME, Cardoso L, Santos J, Cangussu CHC, Leite LN, Quirino MCL, Júnior IGC, Oliveira DA, Xavier MAS (2017) Genetic diversity of Bacillus sp. producers of amylase isolated from the soil. Genet Mol Res. 16(3). doi: 10.4238/gmr16039771 188. YaDeau JT, Klein C, Blobel G (1991) Yeast signal peptidase contains a glycoprotein and the Sec11 gene product. Proceedings of the National Academy of Sciences of the United States of America 88: 517–521. 189. Yamabhai M, Emrat S, Sukasem S, Pesatcha P, Jaruseranee N, Buranabanyat B (2008) Secretion of recombinant Bacillus hydrolytic enzymes using E. coli expression systems. Jof biotechnol 133: 50–57. 190. Yang H, Liu L, Li J, Du G, Chen J (2011) Heterologous expression, biochemical characterization, and overproduction of alkaline α-amylase from Bacillus alcalophilus in Bacillus subtilis. Microbial.Cell Factories 10: 77-86. 149 191. Yarimizu T, Nakamura M, Hoshida H, Akada R (2015) Synthetic signal sequences that enable efficient secretory protein production in the yeast Kluyveromyces marxianus. Microbial.Cell Factories 14: 20-34. 192. Yavuz E, Gunes H, Harsa S, Yenidunya F (2004) Identification of extracellular enzyme producing thermophilic bacilli from Balcova (Agamemnon) geothermal site by ITS rDNA RFLP. J. of Applied Microbiology 97: 810– 817. 193. Ying Q, Zhang C, Guo F, Wang S, Bie X, Lu F, Lu Z (2012) Secreted expression of a hyperthermophilic α-amylase gene from Thermococcus sp. HJ21 in B. subtilis. J. of Molec. Microbiol. and Biotechnol 22: 392–398. 194. Yokota T, Tonozuka T, Shimura Y, Ichikawa K, Kamitori S, Sakano Y (2001) Structures of Thermoactinomyces vulgaris R-47 α-amylase II complexed with substrate analogues. Bioscience, Biotechnology, and Biochemistry 65: 619–626. 195. Zeng Q, Wei C, Jin J, Wu C, Huang B (2011) Cloning of the gene encoding acid- stable alpha-amylase from Aspergillus niger and its expression in Pichia pastoris. African Journal of Food Science 5 (12): 668–675. 196. Zhang J, Robinson D, Salmon P (2006) A novel function for selenium in biological system: selenite as a highly effective iron carrier for Chinese hamster ovary cell growth and monoclonal antibody production. Biotechnol. Bioeng 95: 1188–1197. 197. Zhang Q, Han Y, Xiao H (2017) Microbial α-amylase: A biomolecular overview. Process Biochemistry 53: 88–101. 198. Zhang W, Yang M, Yang Y, Zhan J, Zhou Y, Zhao X (2016) Optimal secretion of alkali-tolerant xylanase in Bacillus subtilis by signal peptide screening. Appl. Microbiology and Biotechnology 100: 8745–8756. 199. Zhou Y, Liu P, Gan Y, Sandoval W, Katakam AK, Reichelt M, Rangell L, Reilly D (2016) Enhancing full-length antibody production by signal peptide engineering. Microbial Cell Factories 15: 47-58. 200. Zhou Y, Wei W, Che Q, Xu Y, Wang X, Huang X, Lai R (2008) Bacillus pallidus sp. nov., isolated from forest soil. Int J Syst Evol Microbiol. 58: 2850-2854. PHỤ LỤC 1 PHỤ LỤC I. Hình dạng tế bào, hoạt tính catalase và khả năng sinh bảo tử của các chủng đƣợc tuyển chọn STT Kí hiệu Chủng Hình dạng khuẩn lạc Gram Catalase Khả năng sinh bào tử 1 CN1-1 Nhỏ, không tròn, mép gọn, bề mặt hơi lồi, có nếp nhăn to + + + 2 CN1-2 Tròn, màu trắng đục, mép hơi răng cƣa, có viền ở tâm + + + 3 CN1-3 Trắng, mép sần sùi, có nhiều chấm nhỏ, bề mặt khô, lan rộng + + + 4 CN1-5 Trắng, mép sần sùi, có nhiều chấm nhỏ, bề mặt khô, lan rộng + + + 5 CN1-6 Trắng, bề mặt khô, mép xù sì + + + 6 CN2-1 Trắng, bề mặt khô, mép xù sì + + + 7 CN2-7 Đa dạng, Màu nâu đỏ, bề mặt khô, mép răng cƣa + + + 8 CN2-8 Hình trứng, trắng đục hoặc màu kem nhẹ, hơi lồi + + + 9 CN3-1 Trắng, mép sần sùi, có nhiều chấm nhỏ, bề mặt khô, lan rộng + + + 10 CN3-2 Trắng, mép sần sùi, có nhiều chấm nhỏ, bề mặt khô, lan rộng + + + 11 CN3-7 Trắng, bề mặt khô, mép xù sì + + + 12 CN3-8 Nhỏ, không tròn, mép gọn, bề mặt hơi lồi, có nếp nhăn to + + + 13 D1-1 Tròn, nhỏ, màu trắng, mép răng cƣa, bề mặt hơi ƣớt, bóng + + + 14 D1-2 Trắng, bề mặt khô, mép xù sì + + + 15 D1-17 Tròn, màu trắng, bề mặt nhăn, hơi lồi + + + 16 D1-33 nhỏ, không tròn, mép gọn, bề mặt hơi lồi, có nếp nhăn to + + + 17 D1-35 Trắng, bề mặt khô, mép xù sì + + + 18 D2-1 Tròn, nhỏ, màu trắng, mép răng cƣa, bề mặt hơi ƣớt, bóng + + + 19 D2-2 Đa dạng, Màu nâu đỏ, bề mặt khô, mép răng cƣa + + + 2 20 D2-7 Trắng, bề mặt khô, mép xù sì + + + 21 D2-8 Tròn, màu kem bề mặt nhăn, hơi lồi + + + 22 D2-9 Trắng, bề mặt khô, mép xù sì + + + 23 D2-10 nhỏ, trắng trong, bề mặt khô, mép hơi lan + + + 24 D2-11 Tròn, trắng, bề mặt khô, nhăn sóng nhỏ + + + 25 D2-12 Trắng, bề mặt khô, mép xù sì + + + 26 D2-13 Tròn, trắng, bề mặt khô, nhăn sóng nhỏ + + + 27 D2-15 Tròn, màu trắng, bề mặt nhăn, hơi lồi + + + 28 D2-17 Tròn, màu trắng hơi ánh nâu, bề mặt khô, mép gọn màu trong + + + 29 D2-20 Tròn, màu trắng hơi ánh nâu, bề mặt khô, mép gọn màu trong + + + 30 D2-22 Tròn, bề mặt khô, hơi nhăn sóng to, mép gọn + + + 31 D3 Trắng, bề mặt khô, mép xù sì + + + 32 D4 Trắng, bề mặt khô, mép xù sì + + + 33 D5-2 Đa dạng, Màu nâu đỏ, bề mặt khô, mép răng cƣa + + + 34 D6 Đa dạng, Màu nâu đỏ, bề mặt khô, mép răng cƣa + + + 35 D6-1 Tròn, màu trắng hơi ánh nâu, bề mặt khô, mép gọn màu trong + + + 36 D6-3 Trắng, bề mặt khô, mép xù sì + + + 37 D6-6 Nhỏ, tròn, tâm màu vàng hơi nâu, viền trắng trong, bề mặt hơi khô + + + 38 D6-8 tròn, màu trắng, bề mặt khô, nhăn, sóng to + + + 39 D6-9 Trắng, bề mặt khô, mép xù sì + + + 40 D6-10 Trắng, bề mặt khô, mép xù sì + + + 41 D6-11 Nhỏ, màu trắng trong, hơi nâu, bề mặt khô, dẹt + + + 42 D6-12 Trắng đục, bề mặt khô, mép xù sì + + + 43 D6-14 Trắng đục, bề mặt khô, mép xù sì + + + 44 D6-19 Tròn, trắng, bề mặt khô, nhăn sóng nhỏ + + + 45 D7 Tròn, trắng, bề mặt khô, nhăn sóng nhỏ + + + 46 D7-1 Trắng đục, bề mặt khô, mép xù sì + + + 47 D7-4 Tròn, trắng, bề mặt khô, nhăn sóng nhỏ, mép răng cƣa + + + 48 D7-5 Tròn, trắng, bề mặt khô, nhăn sóng nhỏ + + + 49 D7-6 Tròn, trắng, bề mặt khô, nhăn sóng nhỏ + + + 50 D7-10 Màu nâu đỏ, bề mặt khô, mép răng cƣa + + + 51 D7-11 Trắng đục, bề mặt khô, mép xù sì + + + 3 52 D8-1 Trắng đục, bề mặt khô, mép xù sì + + + 53 D8-2 Trắng, bề mặt nhẵn, trơn, hơi bóng + + + 54 D8-4 Tròn nhỏ, màu trắng, bề mặt khô, khi khuẩn lạc già có nếp nhăn nhẹ + + + 55 D8-5 Tròn, màu kem bề mặt nhăn, hơi lồi + + + 56 D8-6 Trắng đục, bề mặt khô, mép xù sì + + + 57 D8-11 Tròn, màu trắng, bề mặt nhăn, khô, mép gọn + + + 58 D8-12 Trắng đục, bề mặt khô, mép xù sì + + + 59 D9 Trắng đục, bề mặt khô, mép xù sì + + + 60 D9-1 Tròn, nhỏ, màu kem khuẩn lạc chuyển màu cà phê khi nuôi cấy thời gian dài + + + 61 D9-2 Tròn, màu trắng, bề mặt nhăn, khô, mép gọn + + + 62 D9-3 Trắng đục, bề mặt khô, mép xù sì + + + 63 D9-4 Tròn, màu trắng hơi ánh nâu, bề mặt khô, mép gọn màu trong + + + 64 D9-5 tròn không đều, màu nâu, có đƣờng viền phân tâm, tâm có nếp nhăn + + + 65 D9-7 Tròn, màu trắng hơi ánh nâu, bề mặt khô, mép gọn màu trong + + + 66 D9-11 Trắng, bề mặt khô, mép xù sì + + + 67 D9-12 Nhỏ, màu trắng, bề mặt khô, khi mọc dính chặt vào thạch, mép hơi lan + + + 68 D9-13 Tròn, màu trắng, bề mặt nhăn, khô, mép gọn + + + 69 D9-14 Trắng đục, bề mặt khô, mép xù sì + + + 70 DP1-1 To, màu trắng, hơi ánh nâu đỏ, mặt hơi bóng, bề mặt có nếp nhăn + + + 71 DP1-2 To, màu trắng, hơi ánh nâu đỏ, mặt hơi bóng, bề mặt có nếp nhăn + + + 72 DP2 Trắng đục, bề mặt khô, mép xù sì + + + 73 DP3 Tròn, màu trắng hơi ánh nâu, bề mặt khô, mép gọn màu trong + + + 74 DP4 Trắng đục, bề mặt khô, mép xù sì + + + 75 DP5 Trắng đục, bề mặt khô, mép xù sì + + + 76 DA23 Nhỏ, màu trắng, bề mặt khô, khi mọc dính chặt vào thạch, mép hơi lan + + + 77 DA24 Nhỏ, màu trắng, bề mặt khô, khi mọc dính chặt vào thạch, mép hơi lan + + + 78 GL1-1 Màu trắng, bề mặt khô, mép xù sì + + + 4 79 GL1-2 To, màu trắng, bề mặt nhẵn, mép răng cƣa + + + 80 GL1-4 To, màu trắng, bề mặt khô, có viền tâm, mép xù sì + + + 81 GL1-5 Tròn, màu kem bề mặt nhăn, hơi lồi + + + 82 GL1-7 Nhỏ, bề mặt nhẵn, tâm vàng chanh viền trắng + + + 83 GL1-8 To, màu trắng đục, mép xù sì, ở giữa nhăn + + + 84 GL2-1 To, màu trắng đục, mép xù sì, ở giữa nhăn + + + 85 GL2-2 Tròn nhỏ, màu vàng chanh, bề mặt khô, hơi bóng + + + 86 GL2-3 To, màu trắng, hơi ánh nâu đỏ, mặt hơi bóng, bề mặt có nếp nhăn + + + 87 GL2-4 Trắng, mép sần sùi, có nhiều chấm nhỏ, bề mặt khô + + + 88 GL2-6 Trắng, bề mặt bóng, mép có tia lan rộng + + + 89 GL2-7 Trắng, mép sần sùi, có nhiều chấm nhỏ, bề mặt khô + + + 90 GL2-8 To, màu trắng, bề mặt nhẵn, mép răng cƣa + + + 91 ML1-3 Khuẩn lạc màu vàng chanh, bề mặt khô, mép gọn + + + 92 ML1-4 Trắng đục, bề mặt khô, có nhiều nếp nhăn với sóng to, mép gọn + + + 93 ML1-5 Khuẩn lạc nhẵn, màu trắng, bề mặt khô, mép xù sì + + + 94 RRM1- 1 tròn, bề mặt khô, màu trắng, mép xù sì + + + 95 RRM1- 2 To, màu trắng đục, mép xù sì, ở giữa nhăn + + + 96 RRM1- 3 tròn, màu trắng, bề mặt nhăn, sóng to + + + 97 RRM2 Tròn, màu trắng, bề mặt nhăn, lồi + + + 98 RRM3- 1 tròn, màu trắng, bề mặt nhăn, sóng to + + + 99 RRM3- 2 ovan, màu trắng, bề mặt khô, mép gọn + + + 100 RRM4 Tròn, màu kem bề mặt nhăn, hơi lồi + + + 101 RRM5- 2 Tròn, màu trắng, bề mặt hơi nhăn, khô, mép gọn + + + 102 RRM5- 3 Tròn, màu trắng, bề mặt hơi nhăn, khô, mép gọn + + + 103 RRM5- 4 Nhỏ, trắng đục, bề mặt khô, mép có hình răng cƣa màu trong, hơi xù sì + + + 104 RRM8 To, màu trắng sáng, bề mặt khô + + + 105 TB1-1 Tròn, màu kem và hơi nâu cà phê khi khuẩn lạc già, bề mặt nhăn, hơi lồi + + + 5 106 TB1-2 tròn, màu trắng, bề mặt nhăn, sóng to + + + 107 TB2-1 Trắng đục, bề mặt khô, mép có hình răng cƣa màu trong, hơi xù sì + + + 108 TB2-2 Tròn, màu trắng, bề mặt nhăn, hơi lồi + + + 109 TH1-1 Nhỏ, trắng, bề mặt khô, mỏng khi mọc sát thạch, mép gọn, có nếp nhăn + + + 110 TH1-2 tròn, màu trắng, bề mặt nhăn, sóng to + + + 111 TH2 tròn, màu trắng, bề mặt nhăn, sóng to + + + 112 TH5-1 Tròn, màu trắng, bề mặt nhăn, hơi lồi + + + 113 TH5-2 Tròn, màu trắng, bề mặt hơi nhăn, khô, mép gọn + + + 114 TR1 To, tròn, trắng, mép hơi xù sì + + + 115 TR4-1 Bề mặt khô, màu trắng trong, nhiều nếp nhăn + + + 116 TR4-2 Tròn, màu trắng, bề mặt hơi nhăn, khô, mép gọn + + + 117 TR4-3 Tròn, màu trắng, bề mặt hơi nhăn, khô, mép gọn + + + 118 TR5-1 Tròn, màu trắng đục, mép hơi răng cƣa, có viền ở tâm + + + 119 TR5-2 Tròn, màu hơi vàng, bề mặt nhẵn bóng + + + 120 TR5-3 Nhỏ, màu trắng, bề mặt khô, mép hơi lan + + + 121 TT2-1 nhỏ, trắng đục, bề mặt khô, mép có hình răng cƣa màu trong, hơi xù sì + + + 122 TT2-10 Tròn, màu trắng, bề mặt hơi nhăn, khô, mép gọn + + + 123 TT2-2 Tròn, màu trắng, bề mặt hơi nhăn, khô, mép gọn + + + 124 TT2-3 Nhỏ, bề mặt khô, hơi bóng, có mép hình răng cƣa + + + 125 TT2-4 nhỏ, trắng đục, bề mặt khô, mép có hình răng cƣa màu trong, hơi xù sì + + + 126 TT2-5 To, tròn, trắng, mép hơi xù sì + + + 127 TT2-6 To, màu trắng, hơi ánh nâu đỏ, mặt hơi bóng, bề mặt có nếp nhăn + + + 128 TT2-7 To, tròn, trắng, mép hơi xù sì + + + 129 TT2-8 Nhỏ, trắng đục, bề mặt khô, mép có hình răng cƣa màu trong, hơi xù sì + + + 130 TT2-9 Tròn, màu trắng, bề mặt hơi nhăn, khô, mép gọn + + + 6 PHỤ LỤC II. Hoạt tính và hàm lƣợng α amylase của các chủng chọn lọc Ký hiệu chủng Hoạt tính amylase (U/ml) Hàm lƣợng protein tiết (µg/ml) Tỷ lệ hoạt tính amylase trên hàm lƣợng protein tiết tổng số, U/mg Ký hiệu chủng Hoạt tính amylase (U/ml) Hàm lƣợng protein tiết (µg/ml) Tỷ lệ hoạt tính amylase trên hàm lƣợng protein tiết tổng số, U/mg CN1-1 5,70±0,40 1441,64±6,11 3,95 D9-11 6,28±0,67 1085,19±4,64 5,79 CN1-2 2,53±0,76 1553,18±6,14 1,63 D9-12 2,79±0,59 1293,53±5,53 2,16 CN1-3 3,51±0,52 1179,57±13,10 2,98 D9-13 7,33±0,57 1617,70±6,92 4,53 CN1-5 6,93±0,21 1368,06±15,38 5,07 D9-14 3,93±0,43 1690,31±7,23 2,33 CN1-6 1,52±0,47 1167,37±12,96 1,30 DP1-1 8,01±0,65 1412,87±4,76 5,67 CN2-1 2,24±0,92 1631,07±18,11 1,37 DP1-2 7,81±0,65 1770,99±7,57 4,41 CN2-7 6,50±0,56 1269,36±14,09 5,12 DP2 3,82±0,54 1348,03±4,05 2,83 CN2-8 8,41±0,37 1750,91±19,44 4,80 DP3 7,58±0,98 1591,55±3,81 4,76 CN3-1 3,40±0,27 1171,43±13,01 2,90 DP4 3,90±0,65 1347,41±5,76 2,89 CN3-2 6,50±0,44 1540,13±17,10 4,22 DP5 4,01±0,27 1879,92±8,04 2,13 CN3-7 4,48±0,44 1285,33±14,27 3,49 DA23 14,23±0,92 1563,87±6,69 9,10 CN3-8 5,31±0,36 1548,03±16,08 3,43 DA24 11,23±0,52 1445,53±6,18 7,77 D1-1 5,64±0,15 1220,24±13,55 4,62 GL1-1 5,34±0,7 1069,05±4,57 5,00 D1-2 2,53±0,32 1232,45±13,68 2,05 GL1-2 6,89±0,5 1190,08±5,09 5,79 D1-17 6,97±0,33 1215,86±16,83 5,73 GL1-4 7,86±0,55 1274,79±5,45 6,17 D1-33 8,54±0,21 1532,45±13,68 5,57 GL1-5 11,24±0,79 1303,03±5,57 8,63 D1-35 3,14±0,31 1476,50±16,39 2,13 GL1-7 3,66±0,26 1625,76±6,95 2,25 D2-1 6,21±0,26 1675,81±18,61 3,71 GL1-8 4,9±0,92 1133,59±4,58 4,32 D2-2 8,61±0,1 1830,37±20,32 4,70 GL2-1 5,82±0,84 1420,02±6,07 4,10 D2-7 3,98±0,33 1460,23±16,21 2,73 GL2-2 10,61±1,2 1573,32±6,73 6,74 D2-8 10,21±0,25 1479,20±17,53 6,90 GL2-3 11,83±0,69 1504,74±6,44 7,86 D2-9 3,50±0,36 1374,51±9,71 2,55 GL2-4 3,17±0,57 1609,63±6,88 1,97 7 D2-10 4,39±0,27 1696,14±18,83 2,59 GL2-6 5,09±0,78 1940,43±8,30 2,62 D2-11 7,70±1,13 1754,09±17,25 4,39 GL2-7 4,48±0,89 1936,39±8,28 2,31 D2-12 3,90±0,26 1651,40±18,33 2,36 GL2-8 6,34±0,47 1435,31±5,71 4,42 D2-13 10,33±0,5 1618,87±17,97 6,38 ML1-3 8,55±0,74 1433,59±4,85 5,96 D2-15 5,35±0,56 1600,17±6,99 3,34 ML1-4 4,92±0,67 1641,90±7,02 3,00 D2-17 4,49±0,56 1517,19±6,62 2,96 ML1-5 5,18±0,59 1276,27±4,18 4,06 D2-20 8,65±0,61 1845,18±8,49 4,69 RRM1-1 3,65±0,47 1084,33±4,21 3,37 D2-22 2,48±0,56 1145,80±5,00 2,16 RRM1-2 7,97±0,51 1675,41±3,74 4,76 D3 4,65±0,65 1402,62±6,12 3,32 RRM1-3 5,34±1,31 1355,24±3,66 3,94 D4 2,07±0,96 1328,49±4,05 1,56 RRM2 10,52±1,21 1504,74±6,44 6,99 D5-2 14,12±0,99 1520,47±7,51 9,29 RRM3-1 10,38±1,01 1584,57±6,35 6,55 D6 10,09±0,67 1473,73±6,44 6,85 RRM3-2 11,33±0,59 1475,03±7,59 7,68 D6-1 7,62±0,62 1343,35±5,87 5,67 RRM4 12,84±0,74 1608,76±6,88 7,98 D6-3 2,25±1,03 1031,22±4,50 2,18 RRM5-2 8,59±0,45 1242,52±5,31 6,91 D6-6 5,28±0,17 1210,10±4,19 4,36 RRM5-3 7,59±0,68 1702,41±7,28 4,46 D6-8 3,14±0,77 1213,91±3,55 2,59 RRM5-4 11,00±0,71 1488,60±6,37 7,39 D6-9 3,07±0,45 1173,46±5,12 2,62 RRM8 10,76±0,79 1549,11±6,62 6,95 D6-10 7,53±0,31 1841,18±8,04 4,09 TB1-1 10,05±0,66 1380,96±6,76 7,28 D6-11 6,43±0,08 1248,53±5,45 5,15 TB1-2 7,94±0,42 1473,08±4,59 5,39 D6-12 8,53±0,23 1054,92±4,61 8,09 TB2-1 5,75±0,39 1511,34±7,75 3,80 D6-14 3,87±0,14 1036,39±4,09 3,73 TB2-2 5,70±0,92 1334,67±3,14 4,27 D6-19 10,61±0,46 1556,71±6,80 6,82 TH1-1 6,28±0,86 1054,21±4,51 5,96 D7 8,16±0,15 1536,68±5,4 5,31 TH1-2 11,03±0,78 1889,16±8,08 5,84 D7-1 6,48±0,13 1260,38±5,50 5,14 TH2 7,84±0,68 1379,23±3,76 5,68 D7-4 11,03±0,25 1529,35±6,68 7,21 TH5-1 6,22±0,33 2119,67±9,07 2,93 D7-5 11,49±0,36 1805,62±7,88 5,81 TH5-2 7,1±0,56 1932,36±8,26 3,67 D7-6 8,90±0,72 2086,15±9,11 4,27 TR1 3,63±0,65 1311,10±5,61 2,77 D7-10 5,22±0,62 1608,07±7,02 3,25 TR4-1 12,72±0,86 1658,04±7,09 7,67 D7-11 4,90±0,46 1149,75±5,02 4,26 TR4-2 8,50±0,3 1488,60±6,37 5,71 D8-1 4,09±0,77 1683,53±2,98 2,43 TR4-3 10,74±0,71 1590,93±5,52 6,75 8 D8-2 4,61±0,44 1879,45±3,76 2,45 TR5-1 8,60±0,4 1698,38±7,26 5,06 D8-4 9,55±0,58 1658,04±7,09 5,76 TR5-2 11,79±0,61 1562,93±7,54 7,54 D8-5 12,82±1,03 1441,92±6,17 8,89 TR5-3 10,27±0,69 1460,36±6,25 7,03 D8-6 4,25±0,85 1508,77±6,45 2,82 TT2-1 4,04±0,37 1137,63±4,87 3,55 D8-11 5,94±0,74 1078,59±3,33 5,51 TT2-2 12,23±0,48 1764,86±5,41 6,93 D8-12 2,95±0,62 1024,68±4,38 2,88 TT2-3 2,71±0,71 1016,60±4,35 2,67 D9 3,61±0,56 1097,29±4,69 3,29 TT2-4 3,54±0,63 1101,33±4,71 3,21 D9-1 11,18±1,05 1469,30±6,28 7,61 TT2-5 4,18±0,71 1637,86±7,00 2,55 D9-2 3,83±0,59 1444,22±6,18 2,65 TT2-6 8,98±0,63 1415,99±6,06 6,34 D9-3 3,99±0,32 1149,73±4,92 3,47 TT2-7 5,90±0,78 1391,78±5,95 4,24 D9-4 11,15±0,99 1615,99±6,06 6,90 TT2-8 9,66±0,63 1658,34±7,09 5,83 D9-5 9,46±0,57 1359,51±5,81 6,96 TT2-9 5,60±0,68 1407,69±3,88 3,98 D9-7 10,17±0,79 1767,16±5,42 5,75 TT2-10 4,71±0,44 2129,44±9,96 2,21 9 PHỤ LỤC III Kết quả thử kit API 50 CHB của một số chủng vi khuẩn chọn lọc 10 PHỤ LỤC IV. ĐIỂM XỬ LÝ PHÂN CẮT CỦA CÁC ĐOẠN SP Trình tự nucleotide, protein và vị trí phân cắt peptide tín hiệu gen α-amylase của chủng DA23 Trình tự nucleotide, protein và vị trí phân cắt peptide tín hiệu gen α-amylase của chủng D5-2 11 Trình tự nucleotide, protein và vị trí phân cắt peptide tín hiệu gen α-amylase của chủng CN1-5. 12 PHỤ LỤC V PHÂN TÍCH PROTEIN THEO LOWRY Phƣơng pháp này dựa trên cơ sở phức chất đồng protein khử hỗn hợp photphomolipden- photphovonphramat (thuốc thử Folin- ciocalteu) tạo phức chất màu xanh da trời có độ hấp thụ cực đại ở bƣớc sóng 750nm. Cƣờng độ màu của hỗn hợp phản ứng tỉ lệ thuận với nồng độ protein trong một phạm vi nhất định. Dựa vào mức độ hấp thụ quang học của protein chuẩn, ta có thể xác định đƣợc hàm lƣợng protein trong mẫu nghiên cứu Dung dịch dùng cho phƣơng pháp xác định hàm lƣợng protein theo Lowry + Dung dịch A: 2,85g NaOH và 14,31g Na2CO3 pha trong 500ml nƣớc cất. + Dung dịch B: 1,42g CuS04.5H2O pha trong 100ml nƣớc cất. + Dung dịch C: 2,85g Na2 Tartrate.2H2O pha trong 100ml nƣớc cất. + Dung dịch D (Lowry solution; 0,7mL/mẫu): trộn dung dịch A, dung dịch B, dung dịch C theo tỉ lệ 100:1:1 + Dung dich E: Thuốc thử folin (0,1 ml/mẫu): 5ml thuốc thử Folin - Ciocalteu’s Phenol + 5ml nƣớc đề ion. DUONG CHUAN PROTEIN y = 0.0021x - 0.0084 R2 = 0.9953 -0.05 0 0.05 0.1 0.15 0.2 0.25 0.3 0.35 0.4 0.45 0 50 100 150 200 250 OD Linear (OD) Đồ thị đƣờng chuẩn protein 13 PHỤ LỤC VI PHƢƠNG PHÁP XÁC ĐỊNH HOẠT TÍNH BẰNG DNSA Nguyên tắc phản ứng: Phƣơng pháp này dựa trên nguyên tắc có mặt của nhóm carbonyl tự do (C=O). Phản ứng này ôxi hóa nhóm chức aldehyt có mặt trong glucose hoặc nhóm ketone trong fructose. 3,5-dinitrosalicylic acid (DNS) bị khử thành 3-amino,5-nitrosalicylic acid dƣới điều kiện môi trƣờng kiềm. Màu phản ứng phụ thuộc vào chính xác lƣợng đƣờng khử trong dung dịch. Nồng độ các chất bổ sung trong mẫu thí nghiệm đƣờng khử Tên đối tƣợng mẫu Thể tích dịch enzyme (ml) Thể tích dịch tinh bột trong đệm (ml) Đệm/nƣớc cất Thể tích DNSA (ml) Đối chứng 1 0 0 1 3 Đối chứng 2 0 0.5 0.5 3 Đối chứng 3 0.5 0 0.5 3 Mẫu 0.5 0.5 0 3 Duong chuan glucose 1 y = 5.3486x + 0.0619 R2 = 0.9934 0 5 10 15 20 25 30 0 1 2 3 4 5 6 Đồ thị đƣờng chuẩn glucose 14 PHỤ LỤC VII. CHUẨN BỊ CÁC DUNG DỊCH NGHIÊN CỨU Pha IPTG: + 1.2g IPTG pha vào 50ml nƣớc sau đó lọc qua filter-sterilise và bảo quản ở 4ºC. 5-bromo-4-chloro-3-indolyl-b-D-galactoside (2ml): + 100mg X-Gal hòa trong 2ml N, N’-dimethylformamide. Bảo quản ở - 20ºC, tránh ánh sáng. TE (Tris/EDTA) buffer pH 8.0 : + Tris/HCl pH 8.0 10mM EDTA pH 8.0 10mM 10% SDS (sodium dodecyl sulphate): + 10g SDS trong 100ml nƣớc deion khử trùng và bảo quản ở nhiệt độ phòng. CTAB/NaCl + Cân 10% cetyltrimethylammonium bromide và 0.7 M NaCl và bổ sung nƣớc đến 100ml. Dung dịch A Tách chiết DNA tổng số + 567 µl 1xTE, 30 µl SDS 10% và 3 µl proteinase K 20 mg/ml Tách plasmid của E.coli + Sol I: 50mM glucose, 25mM Tris – HCl (pH 8), 10mM EDTA(pH 8) + Sol II: 0.2N NaOH, 1% SDS + Sol III: 60.0 ml potassium acetate 5M; 11.5 ml acetic acid; H2O, 28.5 ml. Tách chiết DNA plasmid Bacillus + SET: 25% sucrose, 50mM EDTA, 50mM Tris – HCl pH 8 + Sol II: 0.2N NaOH; 1% SDS 15 LOCUS KU214590 366 bp DNA linear BCT 17- MAY-2016 DEFINITION Bacillus licheniformis strain DA23 alpha amylase gene, partial cds. ACCESSION KU214590 VERSION KU214590.1 KEYWORDS . SOURCE Bacillus licheniformis ORGANISM Bacillus licheniformis Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus. REFERENCE 1 (bases 1 to 366) AUTHORS Da,N.T.Man T.D, Thoa, N.K TITLE Signal peptide sequences of alpha amylase gene of bacillus sp. d5-2 and bacillus sp. da23 isolated from soil JOURNAL Unpublished REFERENCE 2 (bases 1 to 366) AUTHORS Da,N.T.Man T.D, Thoa, N.K TITLE Direct Submission JOURNAL Submitted (01-DEC-2015) Biomaterial, IBT, VAST, 18, Hoang Quoc Viet, Cau Giay, Ha Noi 084, Viet Nam FEATURES Location/Qualifiers source 1..366 /organism="Bacillus licheniformis" /mol_type="genomic DNA" /strain="DA23" /isolation_source="soil" /db_xref="taxon:1402" /country="Viet Nam" /collection_date="22-Nov-2010" /collected_by="Da, N T" CDS 1..>366 /EC_number="3.2.1.1" /codon_start=1 /transl_table=11 /product="alpha amylase" /protein_id="AND80847.1" /translation="MKQQKRLYARFCCRLLFALIFLLPHSAAAAANLKGTLMQYFEWY MPNDGQHWKRLQNDSAYLAEHGITAVWIPPAYKGTSQADVGYGAYDLYDLGEFHQKGT VRTKYGTKGELQSAIKSLHT" ORIGIN 1 atgaaacaac aaaaacggct ttacgcccga ttttgctgcc gcctgttatt tgcgctcatc 61 ttcttgctgc ctcattctgc agcagcggcg gcaaatctta aagggacgct gatgcagtat 121 tttgaatggt acatgcccaa tgacggccaa cattggaagc gcttgcaaaa cgactcggca 181 tatttggctg aacacggtat tactgccgtc tggattcccc cggcatataa gggaacgagc 241 caagcggatg tgggctacgg tgcttacgac ctttatgatt taggggagtt tcatcaaaaa 301 gggacggttc ggacaaagta cggcacaaaa ggagagctgc aatctgcgat caaaagtctt 361 catacc // 16 LOCUS KU214591 352 bp DNA linear BCT 17- MAY-2016 DEFINITION Bacillus cereus strain CN1-5 alpha amylase gene, partial cds. ACCESSION KU214591 VERSION KU214591.1 KEYWORDS . SOURCE Bacillus cereus ORGANISM Bacillus cereus Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus cereus group. REFERENCE 1 (bases 1 to 352) AUTHORS Da,N.T.Man T.D, Thoa, N.K TITLE Signal peptide sequences of alpha amylase gene of bacillus sp. d5-2 and bacillus sp. da23 isolated from soil JOURNAL Unpublished REFERENCE 2 (bases 1 to 352) AUTHORS Da,N.T.Man T.D, Thoa, N.K TITLE Direct Submission JOURNAL Submitted (01-DEC-2015) Biomaterial, IBT, VAST, 18, Hoang Quoc Viet, Cau Giay, Ha Noi 084, Viet Nam FEATURES Location/Qualifiers source 1..352 /organism="Bacillus cereus" /mol_type="genomic DNA" /strain="CN1-5" /isolation_source="soil" /db_xref="taxon:1396" /country="Viet Nam" /collection_date="31-Oct-2010" /collected_by="Da, N T" CDS 1..>352 /EC_number="3.2.1.1" /codon_start=1 /transl_table=11 /product="alpha amylase" /protein_id="AND80848.1" /translation="MFKKVTIVGLSVVMFLPSIYEGSKAYADTVNNGTLMQYFEWYAP NDGNHWNRLRTDVENLAEKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVR TKYGTKAQLKSAIDA" ORIGIN 1 atgtttaaaa aagtaacaat agtcggattg tcggttgtta tgtttttacc tagtatatat 61 gaggggagta aagcatatgc agacacagtt aacaatggaa cgttaatgca gtattttgag 121 tggtatgctc cgaatgatgg gaatcattgg aatcgtttgc gtactgatgt tgaaaattta 181 gcggaaaaag gaattacatc tgtttggata ccacctgcat ataaaggaac tacgcaaaat 241 gacgtaggat atggagcata tgatttatat gatctggggg aattcaatca aaagggcaca 301 gtgcggacga aatatgggac gaaagcacaa ttgaaatctg caattgacgc tt // 17 LOCUS KU214589 397 bp DNA linear BCT 17- MAY-2016 DEFINITION Bacillus subtilis strain D5-2 alpha amylase gene, partial cds. ACCESSION KU214589 VERSION KU214589.1 KEYWORDS . SOURCE Bacillus subtilis ORGANISM Bacillus subtilis Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus. REFERENCE 1 (bases 1 to 397) AUTHORS Da,N.T.Man T.D, Thoa, N.K TITLE Signal peptide sequences of alpha amylase gene of bacillus sp. d5-2 and bacillus sp. da23 isolated from soil JOURNAL Unpublished REFERENCE 2 (bases 1 to 397) AUTHORS Da,N.T.Man T.D, Thoa, N.K TITLE Direct Submission JOURNAL Submitted (01-DEC-2015) Biomaterial, IBT, VAST, 18, Hoang Quoc Viet, Cau Giay, Ha Noi 084, Viet Nam FEATURES Location/Qualifiers source 1..397 /organism="Bacillus subtilis" /mol_type="genomic DNA" /strain="D5-2" /isolation_source="soil" /db_xref="taxon:1423" /country="Viet Nam" /collection_date="22-Nov-2010" /collected_by="Da, N T" CDS 1..>397 /EC_number="3.2.1.1" /codon_start=1 /transl_table=11 /product="alpha amylase" /protein_id="AND80846.1" /translation="MFKKRFKTSLLPLFAGFLLLFHLVLSGPAAANAETANKSNKVTA SSVKNGTILHAWNWSFNTLTQNMKDIRDAGYAAIQTSPINQVKEGNQGDKSMRNWYWL YQPTSYQIGNRYLGTEQEFKDMWQPRIKYG" ORIGIN 1 atgtttaaaa aacgattcaa aacctcttta ctgccgttat tcgccggatt tttattgctg 61 tttcatttgg ttttgtcagg cccggcggct gcaaacgctg aaactgcaaa caaatcgaat 121 aaggtgaccg cgtcatcggt caaaaacggg accatccttc atgcatggaa ttggtcgttc 181 aatacgttaa cacaaaatat gaaagatatt cgtgatgcgg gctatgcagc cattcagacg 241 tctccgatta accaagtaaa ggaagggaac caaggagata aaagcatgag gaactggtac 301 tggctgtatc agccgacatc gtaccaaatc ggcaaccgtt acttaggcac tgaacaagaa 361 tttaaggaca tgtggcagcc gcggataaag tatggcg //

Các file đính kèm theo tài liệu này:

  • pdfluan_an_sang_loc_va_nghien_cuu_anh_huong_cua_dot_bien_diem_t.pdf
Luận văn liên quan