Đề tài Tách dòng và thiết kế vector chuyển gen của gen mã hoá protein vỏ (coat protein) từ virus gây bệnh đốm vòng cây đu đủ (PRSV) ở Việt Nam

Mục lục Mở đầu Phần 1 Tổng quan tài liệu 1.1. Đặc điểm của cây đu đủ 1.1.1. Nguồn gốc và phân loại 1.1.2. Giá trị kinh tế 1.1.3. Phân bố 1.1.4. Các bệnh về cây đu đủ 1.2. Đặc điểm virus gây bệnh đốm vòng ở đu đủ (PRSV) 1.2.1. Cấu trúc 1.2.2. Cơ chế lan truyền 1.2.3. Các biện pháp phòng trừ 1.2.4. Gen kháng virus 1.2.5. Những thành tựu trong việc chống lại PRSV ở cây đu đủ 1.2.5.1. Trường đại học Hawaii và đại học Cornell, Mỹ 1.2.5.2. Trường đại học Kasetsart, Thailand và Queensland, Austrailia 1.2.5.3. Trung tâm Công nghệ sinh học, MARDI, Malaysia 1.3. Công nghệ sinh học phân tử và ứng dụng để tạo cây chuyển gen 1.3.1. Một số vector sử dụng trong sinh học phân tử 1.3.1.1 Vector nhân dòng TA-cloning 1.3.1.2 Vector biểu hiện protein pRSET 1.3.1.3 Vector chuyển gen 1.3.2. Một số loại enzim sử dụng trong sinh học phân tử 1.3.2.1 Enzim sao mã ngược (reverse transcriptase) 1.3.2.2 Enzim ligase 1.3.2.3 Enzim DNA polymerase 1.3.2.4 Enzim cắt giới hạn (restriction enzim) 1.3.2.5 Enzim Mung-bean nuclease 1.3.3. Một số kỹ thuật sinh học phân tử 1.3.3.1 Kỹ thuật RT-PCR 1.3.3.2 Kỹ thuật Western blotting 1.4. Công nghệ thông tin và ứng dụng trong sinh học phân tử 1.4.1. Phần mềm tin học DNAstar sử dụng trong SHPT 1.4.2. Internet và SHPT. Phần 2 Nguyên liệu và phương pháp nghiên cứu 2.1. Nguyên liệu 2.2. Phương pháp 2.2.1. Tách RNA tổng số chứa mRNA mã hoá protein vỏ của virus PRSV 2.2.2. Phương pháp điện di 2.2.3. Thiết kế Primer 2.2.4. Phương pháp RT-PCR 2.2.5. Phương pháp tách và tinh sạch DNA từ gel Agarose bằng ly tâm 2.2.6. Phản ứng ghép nối đoạn gen với vector 2.2.7. Phương pháp xử lý với enzim giới hạn và Mung-bean nuclease 2.2.8. Phương pháp biến nạp 2.2.9. Kiểm tra khuẩn lạc chứa vector tái tổ hợp bằng PCR 2.2.10. Tách chiết DNA plasmid từ E. coli 2.2.11. Phân tích trình tự nucleotide 2.2.12. Thiết kế vector chuyển gen mang gen PRSVN 2.2.13. Biểu hiện gen CP trong E.coli 2.2.14. Western blotting Phần 3 Kết quả và thảo luận Phần 4 Kết luận và đề nghị Phần 5 Tài liệu tham khảo Mở đầu Đu đủ là cây ăn quả được trồng phổ biến ở vùng nhiệt đới và cận nhiệt đới. Quả chín để ăn tráng miệng và quả xanh được dùng làm salad. Ngoài ra nhựa đu đủ còn là nguyên liệu tách chế phẩm enzim papain có giá trị thương mại sử dụng trong công nghiệp thực phẩm và thuộc da. ở Việt Nam, diện tích trồng đu đủ vào khoảng 2500 ha với sản lượng khoảng 100.000 tấn ước tính đạt 200 - 300 tỉ đồng [17]. Nhưng hạn chế lớn nhất đối với sự phát triển cây đu đủ là sự hoành hành của bệnh đốm vòng do virus đốm vòng (papaya ringspot virus) gây ra. Virus này thuộc nhóm Potyirus có vật liệu di truyền là sợi ARN đơn. Khi virus này nhiễm vào cây đu đủ thì làm cho lá cây có những vòng đốm và mất khả năng quang hợp dẫn đến giảm nghiêm trọng năng suất và chất lượng quả. Bệnh được truyền do các loại rệp cây nên lan rộng rất nhanh. Đến nay toàn bộ các vùng trồng đu đủ ở nước ta [17] cũng như Austrailia [16], Thái Lan [14], Đài Loan [18], Malaysia [10] . và đặc biệt là Hawaii [5] đều đã bị nhiễm bệnh. Những phương pháp thường sử dụng để ngăn chặn sự lan rộng của PRSV như chặt bỏ cây bị bệnh, cách ly vùng bị bệnh [7], sử dụng thuốc trừ sâu để diệt rệp truyền bệnh hay sử dụng chủng PRSV yếu cho nhiễm vào cây chưa bị bệnh để ngăn sự nhiễm các chủng mạnh hơn theo cơ chế bảo vệ chéo [19,20]. Nhưng những phương pháp này chỉ làm giảm sự lan truyền mang tính chất phòng trừ chứ không thể chống lại bệnh này. Hiện nay nhờ ứng dụng tiến bộ mới trong kỹ thuật di truyền, người ta đã tạo ra các giống cây trồng có khả năng kháng lại bệnh do virus gây ra bằng cách đưa gen mã hoá protien vỏ (coat proetin gene) của virus vào genom của thực vật. Thành công đầu tiên là ở thuốc lá và cà chua kháng lại virus khảm thuốc lá [12]. Sau đó là sự kháng lại nhiều loại virus khác như cucumber mosaic virus [1], alfalfa mosaic virus [6] và potato leaf roll virus [4]. Gần đây ở Hawaii đã tạo được dòng đu đủ 55-1 kháng lại PRSV [2,3]. Dòng đu đủ được chuyển gen này đã trở thành giống thương mại sau khi lai với giống Kapoho [9]. Nhưng tính kháng của cây đu đủ chuyển gen này chỉ có hiệu quả đối với các chủng virus của Hawai mà không kháng với các chủng virus từ các vùng khác [15]. Chính vì vậy mà cần phải tách dòng gen mã hoá protien vỏ (coat protein gene) từ chính các virus gây bệnh của vùng đó thì mới có khả năng tạo ra cây kháng bệnh. Xuất phát từ cơ sở trên, chúng tôi đã xây dựng đề tài: " Tách dòng và thiết kế vector chuyển gen của gen mã hoá protein vỏ (coat protein) từ virus gây bệnh đốm vòng cây đu đủ (PRSV) ở việt nam". Với mục đích là tạo được một vector chuyển gen mang gen mã hoá cho protein vỏ của PRSV của Việt Nam phục vụ cho việc chuyển gen này vào cây đu đủ tạo ra giống đu đủ mới có khả năng kháng lại PRSV ở Việt Nam.

doc54 trang | Chia sẻ: lvcdongnoi | Ngày: 05/06/2013 | Lượt xem: 1223 | Lượt tải: 0download
Bạn đang xem nội dung tài liệu Đề tài Tách dòng và thiết kế vector chuyển gen của gen mã hoá protein vỏ (coat protein) từ virus gây bệnh đốm vòng cây đu đủ (PRSV) ở Việt Nam, để tải tài liệu về máy bạn click vào nút DOWNLOAD ở trên
um, Khi c¸c gen trªn vector bæ trî ho¹t ®éng th× c¸c s¶n phÈm cña nã sÏ t¸c ®éng tíi ®o¹n T-DNA trªn vector chuyÓn gen dÉn ®Õn sù chuyÓn ®o¹n T-DNA sang tÕ bµo thùc vËt. 1.3.1.3.3 Vector chuyÓn gen pCAMBIA2300 Vector pCAMBIA2300 ®­îc Leon Smith thuéc trung t©m CAMBIA thiÕt kÕ n¨m 1997 ®Ó lµm vector chuyÓn gen vµo thùc vËt. Vector cã kÝch th­íc 8742bp víi c¸c thµnh phÇn theo s¬ ®å: 1.3.2. Mét sè lo¹i enzim th«ng dông trong sinh häc ph©n tö 1.3.2.1 Enzim phiªn m· ng­îc (reverse transcriptase) Cïng víi c¸c enzim giíi h¹n, enzim phiªn m· ng­îc cã vai trß quyÕt ®Þnh trong qu¸ tr×nh h×nh thµnh ngµnh sinh häc ph©n tö, enzim nµy do c¸c retrovirus s¶n sinh nh»m sao chÐp bé gen RNA cña chóng trong tÕ bµo chñ. HiÖn nay trªn thÞ tr­êng cã hai lo¹i enzim phiªn m· ng­îc cã nguån gèc tõ AMV (Avian Myeloblastosis Virus) vµ th«ng dông h¬n lµ tõ Mo-MLV (Moloney Murine Leukemia Virus) v× enzim nµy ho¹t ®éng ë 420C nªn ®· lµm gi¶m sù t¹o vßng cña sîi mRNA. C¶ hai lo¹i enzim nµy ®Òu cã ho¹t tÝnh 5' - 3' DNA polymerase sö dông sîi mRNA lµm khu«n mÉu víi ®o¹n måi lµ ®o¹n RNA hoÆc DNA cã ®Çu 3'-OH tù do ®Ó sao chÐp ng­îc t¹o ra sîi cDNA. 1.3.2.2 Enzim DNA ligase Enzim DNA ligase ®­îc sö dông ®Ó kÕt nèi hai ®o¹n DNA. Nã xóc t¸c cho ph¶n øng t¹o khung liªn kÕt photphodiester bëi g¾n ®Çu 5'-photphat vµ ®Çu 3'-OH cña hai ®o¹n DNA theo s¬ ®å: 5'...pApCpG-OH pApApTpTpCpGpT...3' 3'...TpGpCpTpTpApAp HO-GpCpAp...5' Mg++ Bacteriophage T4 DNA ligase ATP 5'...pApCpGpApApTpTpCpGpT...3' 3'... TpGpCpTpTpApApGpCpAp...5' Enzim th­êng dïng trong SHPT lµ T4 DNA ligase t¸ch tõ thùc khuÈn thÓ T4, cã cÊu tróc lµ mét chuçi polypepetit víi träng l­îng ph©n tö lµ 68kDa, ho¹t ®éng tèi ­u ë pH7,5 ®Õn 8,0 vµ cÇn cã phô tè lµ ion Mg++ vµ ATP 1.3.2.3. Enzim DNA polymerase DNA polymerase xóc t¸c cho ph¶n øng tæng hîp chuçi polynucleotit tõ c¸c mononucleotit. Qu¸ tr×nh tæng hîp lu«n ®­îc kÐo dµi tõ ®Çu tËn cïng 3'-OH cña ®o¹n måi. Enzim nµy chñ yÕu ®­îc øng dông cho ph¶n øng PCR. Tr­íc ®©y, khi míi ph¸t minh ra PCR vµo n¨m 1985 th× enzim ®­îc sö dông lµ T4 polymerase (enzim Klenow). Nh­ng ®iÒu h¹n chÕ lµ enzim nµy chØ ho¹t ®éng ë nhiÖt ®é thÊp (370C), nªn sau nµy ®· ®­îc thay thÕ b»ng c¸c DNA polymerase chÞu nhiÖt. DNA polymerase chÞu nhiÖt ®Çu tiªn ®­îc t¸ch tõ chñng vi khuÈn Thermus aquaticus Yt1 ph©n lËp tõ suèi n­íc nãng ë vïng Yellow store. Trong sè c¸c enzim chÞu nhiÖt th× Taq DNA polymerase ®­îc dïng phæ biÕn h¬n v× nã ®· ®­îc s¶n xuÊt tõ E.coli b»ng kü thuËt ADN t¸i tæ hîp. Ngoµi ra cßn mét sè c¸c enzim kh¸c còng th­êng ®­îc sö dông nh­: enzim Taq Vent Tth Pfu Bst Nguån E.coli ®­îc biÕn n¹p gen Taq DNA polumerase t¸i tæ hîp Thermococus litoralis Thermus thermophilus HB8 Pyrococcus furiosus Mesophilic bacterim bacillus. Stearothermophilus T-3468 Mr 94kDa - 92kDa 92kDa 76kDa Tèc ®é tæng hîp (nucleotit/s) 75 >80 >25 >60 >120 §é bÒn víi nhiÖt ®é 97,50C 950C 92,50C 10' 40' 130' 130' 130' - - 20' - > 2h >3h - - - [MgCl2]opt 1,5mM 2,0mM 1,5mM 1,5-2mM 1,5mM [KCl]opt 50mM 10mM 80mM 10mM 80mM 1.3.2.4 Enzim c¾t giíi h¹n (restriction enzim) enzim giíi h¹n lµ c«ng cô c¬ b¶n phôc vô cho sinh häc ph©n tö, ®­îc sö dông ®Ó x¸c ®Þnh ®Æc ®iÓm cña tr×nh tù nucleotide cña ®o¹n DNA, t¹o ra c¸c ®o¹n c¾t DNA phôc vô cho lai ghÐp DNA. Enzim giíi h¹n lµ mét lo¹i enzim cña vi khuÈn cã t¸c dông gióp chóng chèng l¹i nh÷ng DNA ngo¹i lai x©m nhËp. Enyme ®­îc tinh chÕ lÇn ®Çu tiªn vµo n¨m 1970 tõ Haemophilus influenzae Rd. enzim giíi h¹n ®­îc chia lµm 3 lo¹i dùa trªn sù c¾t DNA ®Æc hiÖu hay kh«ng ®Æc hiÖu vµ c¸c yÕu tè phô cÇn cho ho¹t tÝnh cña enzim. + Enyme giíi h¹n lo¹i I: lµ nh÷ng enzim c¾t DNA ë nh÷ng vÞ trÝ kh«ng ®Æc hiÖu c¸ch xa vÞ trÝ liªn kÕt hoÆc vÞ trÝ ghi nhËn tr×nh tù c¸c nucleotide trªn m¹ch DNA kho¶ng 7000bp vµ ®Ó cho enzim ho¹t ®éng cÇn 3 phô tè lµ Mg2+, ATP vµ adenozylmethionyl. + Enzim giíi h¹n lo¹i III: enyme nµy còng c¾t ë nh÷ng vÞ trÝ kh«ng ®Æc hiÖu nh­ng vÞ trÝ c¾t c¸ch vÞ trÝ nhËn biÕt chØ kho¶ng 25 ®Õn 27bp vµ cÇn hai phô tè lµ ATP vµ Mg2+. Hai lo¹i enzim nµy do vÞ trÝ c¾t kh«ng ®Æc hiÖu nªn kh«ng ®­îc sö dông trong kü thuËt gen. + enzim giíi h¹n lo¹i II: lo¹i nµy chØ cÇn Mg2+ cho ho¹t tÝnh ph©n c¾t DNA vµ vÞ trÝ c¾t cña nã rÊt ®Æc hiÖu. §iÓm c¾t ngay t¹i n¬i enzim g¾n vµo hoÆc kÒ cËn. PhÇn lín vÞ trÝ nhËn biÕt cña enzim nµy lµ mét tr×nh tù gåm 4 ®Õn 6 bp (®«i khi lµ 7 ®Õn 8bp). Khi chóng c¾t chuçi DNA kÐp th× sÏ t¹o thµnh c¸c ®o¹n c¾t giíi h¹n cã ®Çu tËn cïng b»ng hoÆc tï víi tr×nh tù c¸c nucleotide ®Æc tr­ng vµ x¸c ®Þnh. 1.3.2.5 Enzim Mung-bean nuclease Mung-bean nuclease ®­îc tinh chÕ tõ mÇm c©y ®Ëu xanh (mung bean) cã ho¹t tÝnh nuclease. Enzim nµy chØ c¾t sîi RNA hoÆc sîi ®¬n DNA mµ kh«ng c¾t DNA sîi ®«i thËm chÝ còng kh«ng c¾t ë trong nh÷ng ®iÓm më trªn sîi DNA. Nã ®­îc dïng ®Ó lo¹i bá ®Çu dÝch sau khi sö lý víi enzim giíi h¹n kh¸c, t¹o ra c¸c ®Çu b»ng gióp cho viÖc g¾n nèi c¸c ®o¹n DNA ®­îc dÔ dµng h¬n. 5'...pApCpG-OH pApApTpTpCpGpT...3' 3'... TpGpCpTpTpApAp HO-GpCpAp...5' Mung Bean nuclease Zn++ <100mM NaCl 5'...pApCpGp + CpGpT...3' 3'... TpGpCp GpCpAp...5' 1.3.3 Mét sè kü thuËt sinh häc ph©n tö 1.3.3.1 Kü thuËt ®iÖn di ph©n tÝch ADN Ph©n tö RNA vµ DNA víi c¸c ®o¹n c¾t cã khèi l­îng kh¸c nhau ®­îc t¸ch ra khi di chuyÓn trong ®iÖn tr­êng tõ cùc ©m sang cùc d­¬ng cña m¸y ®iÖn di. víi nång ®é agarose, ®iÖn thÕ vµ c­êng ®é thÝch hîp thÝch hîp th× cã gi¶i ph©n t¸ch c¸c ®o¹n DNA kÝch th­íc kh¸c nhau. Nång ®é gel agarose §é ph©n gi¶i (Kb) 0,3 0,6 0,7 0,9 1,2 1,5 2 60 - 5 20 - 1 10 - 0,8 7 - 0,5 6 - 0,4 4 - 0,2 3 - 0,1 - Kü thuËt ®iÖn di cho phÐp ph¸t hiÖn vÖt DNA 10ng khi nhuém víi ethidium bromide. Ethidium lµ mét chÊt t­¬ng ®ång víi c¸c baz¬ nªn nã xen kÏ vµo sîi DNA, d­íi ¸nh s¸ng UV th× ph¸t quang vµ ®é ph¸t quang tØ lÖ thuËn víi l­îng DNA. ChiÒu dµi b­íc sãng tèi ­u lµ 254nm nh­ng ®Ó tr¸ch lµm ®øt g·y sîi DNA trong thùc tÕ dung b­íc sãng 300nm. Sù chuyÓn ®éng cña DNA phô thuéc vµo hai yÕu tè: - §é lín cña ®o¹n DNA: nh÷ng ®o¹n DNA kÝch th­íc bÐ chuyÓn ®éng nhanh h¬n vµ sù chuyÓn ®éng cã mèi quan hÖ logarit víi ®é dµi ®o¹n DNA. - KiÓu h×nh cña DNA: §iÒu nµy th­êng thÊy ®èi víi plasmid d¹ng siªu xo¾n, sîi vßng, sîi th¼ng. V× vËy ®Ó t¸ch vµ ph©n biÖt kÝch th­íc plasmid th­êng ph¶i dïng mét sè enzim giíi h¹n ®Ó c¾t plasmid t¹o ra d¹ng m¹ch th¼ng. 1.3.3.2. Kü thuËt ®iÖn di ph©n tÝch protein Ph­¬ng ph¸p nµy dïng ®Ó x¸c ®Þnh sù cã mÆt vµ träng l­îng ph©n tö cña protein. Nguyªn t¾c cña kü thuËt lµ dùa vµo tÝnh chÊt liªn kÕt gi÷a acrylamide vµ bisacrylamide theo tØ lÖ 29:1 t¹o ra d¹ng chuçi polyacrylamide cã t¸c dông nh­ mét r©y ph©n tö. C¸c protein sau khi kÕt hîp víi chÊt tÝch ®iÖn ©m SDS sÏ di chuyÓn ®­îc trong ®iÖn tr­êng tõ cùc ©m sang cùc d­¬ng. Khi cho protein di chuyÓn qua b¶n gel acylamide trong ®iÖn tr­êng th× theo thêi gian c¸c protein cã träng l­îng ph©n tö kh¸c nhau sÏ ph©n bè trªn c¸c vÞ trÝ kh¸c nhau cña b¶n gel. Protein nµo cã träng l­îng ph©n tö nhá h¬n sÏ di chuyÓn vÒ cùc d­¬ng nhanh h¬n. Tuú vµo nång ®é cña acrylamide mµ cã thÓ ph©n t¸ch ®­îc c¸c protein víi gi¶i träng kh¸c nhau theo b¶ng: Nång ®é gel acrylamide (%) Gi¶i träng l­îng ph©n t¸ch (kD) 15 10 7,5 5 12 ¸ 43 16 ¸ 68 36 ¸ 94 57 ¸ 212 Sau khi dõng ®iÖn di, v¹ch protein trªn gel ®­îc ph¸t hiÖn b»ng nhuém gel víi chÊt mµu lµ Coomassie Brillian Blue R250 hoÆc muèi nitrate B¹c. So s¸nh vÞ trÝ cña c¸c protein nµy víi thang protein chuÈn ta sÏ x¸c ®Þnh ®­îc träng l­îng ph©n tö cña chóng. Ph­¬ng ph¸p nµy cã thÓ ph¸t hiÖn v¹ch protein víi hµm l­îng 10ng. Ngoµi ra, ph­¬ng ph¸p cßn cã thÓ x¸c ®Þnh sè chuçi polypeptit cña ph©n tö protein b»ng c¸ch bæ sung vµo ®Öm mÉu protein b-Mecaptoetanol. ChÊt nµy sÏ c¾t c¸c cÇu liªn kÕt disulfua gi÷a c¸c chuçi polypeptit t¹o c¸c tiÓu phÇn nhá. So s¸nh b¨ng ®iÖn di khi kh«ng cã b-Mecaptoetanol ta sÏ biÕt ®­îc ph©n tö protein cÊu tróc tõ bao nhiªu tiÓu phÇn cïng víi kÝch th­íc ph©n tö cña c¸c tiÓu phÇn. 1.3.3.3. Kü thuËt RT-PCR Kü thuËt RT-PCR lµ sù kÕt hîp cña hai ph¶n øng sao m· ng­îc (reverse transcription) vµ PCR ®Ó nh©n lªn mét ®o¹n gen quan t©m tõ RNA tæng sè trong ®ã cã chøa RNA th«ng tin gåm hai giai ®o¹n - Tæng hîp sîi cDNA thø nhÊt (s¬ ®å): CÊu tróc mò ®Çu 5' AAA(A)n ®u«i poly(A) ®Çu 3' mRNA dNTP Reverse transcriptase CÊu tróc mò ®Çu 5' AAA(A)n ®u«i poly(A) ®Çu 3' Oligo(dT)12-18 primer 3'-OH 5' AAA(A)n ®u«i poly(A) ®Çu 3' Oligo(dT)12-18 primer 3'-OH 5' 5' 3' cDNA : mRNA Do tÝnh chÊt mRNA cña tÕ bµo eukaryot bao giê còng ®­îc g¾n thªm mét ®o¹n ®u«i poly(A) nªn trong ®iÒu kiÖn invitro víi sîi khu«n lµ mRNA cã trong RNA tæng sè, nÕu ta sö dông mét ®o¹n måi oligo(dT) kho¶ng 12 ®Õn 18 base th× ®o¹n måi nµy sÏ b¾t cÆp bæ sung víi ®u«i poly(A) cña mRNA. Khi cã mÆt enzim reverse transcriptase vµ c¸c dNTP tù do, ë nhiÖt ®é 420C trong 2h ®o¹n måi nµy sÏ ®­îc kÐo dµi t¹o thµnh c¸c sîi DNA míi bæ sung víi mRNA. Nh­ vËy sîi cDNA thø nhÊt ®· ®­îc tæng hîp. §Ó t¨ng hiÖu qu¶ cña qu¸ tr×nh tæng hîp, l­îng oligo(dT) ®­îc cho vµo lín h¬n rÊt nhiÒu l­îng mRNA vµ chÊt k×m h·m RNase còng ®­îc ®­a vµo ®Ó b¶o vÖ cho RNA khái bÞ ph©n huû bëi RNase. - KhuÕch ®¹i gen quan t©m b»ng PCR: Sau khi sîi cDNA thø nhÊt ®­îc tæng hîp th× kü thuËt PCR ®­îc ¸p dông ®Ó nh©n gen quan t©m víi c¸c cÆp måi ®Æc hiÖu cho gen ®ã. Tr­íc tiªn sîi cDNA t¸ch khái mRNA bëi nhiÖt, sau ®ã ®o¹n måi 1 sÏ kÕt cÆp bæ sung víi sîi cDNA thø nhÊt ®Ó tæng hîp sîi DNA thø hai. TiÕp theo c¸c sîi DNA kÐp nµy sÏ ®­îc nh©n lªn sau mçi vßng lÆp cña ph¶n øng. 1.3.3.4. Kü thuËt Western blotting Kü thuËt western blotting lµ kü thuËt lai protein-protein. Protein mÉu sau khi ®­îc ph©n t¸ch b»ng ®iÖn di gel acrylamide sÏ ®­îc chuyÓn sang cè ®Þnh trªn mét chÊt gi¸ còng b»ng ®iÖn di. ChÊt gi¸ th­êng sö dông lµ c¸c lo¹i mµng kh¸c nhau nh­ mµng nitrocellulose, diazophenylthio (DPT), diazobenzyloxymethyl (DBM), nylon...Protein ®· cè ®Þnh trªn mµng sÏ ®­îc ph¸t hiÖn b»ng ph¶n øng miÔn dÞch kÐp gåm hai giai ®o¹n + Protein mÉu cè ®Þnh trªn mµng ®ãng vai trß mét kh¸ng nguyªn sÏ kÕt hîp víi protein kh¸c cã tÝnh chÊt lµ mét kh¸ng thÓ kh¸ng l¹i protein nµy (kh¸ng thÓ thø nhÊt). Kh¸ng thÓ ®­îc t¹o ra nhê g©y ph¶n øng miÔn dÞch khi tiªm protein mÉu vµo thá hoÆc chuét vµ sau ®ã t¸ch lÊy kh¸ng thÓ tõ huyÕt thanh cña chóng. + Kh¸ng thÓ thø nhÊt l¹i tiÕp tôc ®­îc lai víi kh¸ng thÓ thø hai (kh¸ng thÓ kh¸ng globulin miÔn dÞch anti-immunoglobulin) ®· ®­îc g¾n víi mét protein cã ho¹t tÝnh enzim th­êng lµ peroxidase cñ c¶i ngùa hoÆc alkaline phosphatase. ChÝnh c¸c enzim nµy sÏ ph©n huû c¬ chÊt BCIP/NBT tõ kh«ng mµu thµnh mµu xanh gióp chóng ta quan s¸t ®­îc sù cã mÆt vµ vÞ trÝ cña protein mÉu trªn b¶n gel. 1.4. øng dông c«ng nghÖ tin häc trong sinh häc ph©n tö 1.4.1 PhÇn mÒm tin häc DNAstar sö dông cho sinh häc ph©n tö Cïng víi sù ph¸t triÓn cña SHPT, C«ng nghÖ th«ng tin ®· ph¸t triÓn m¹nh mÏ vµ ®­îc øng dông vµo nhiÒu lÜnh vùc trong ®ã cã sinh häc ph©n tö. Cã nhiÒu hÖ thèng phÇn mÒm kh¸c nhau nh­ ‘NTSYSpc’ dïng ®Ó vÏ c©y ph©n lo¹i c¸c loµi nhê xö lý c¸c sè liÖu cña kü thuËt RADP, ‘Vector NTI’ dïng ®Ó vÏ s¬ ®å c¸c plasmide, ‘CP/gene’ dïng ph©n tÝch tr×nh tù nucleotide vµ protein. Nh­ng tiÖn dông nhÊt lµ hÖ thèng phÇn mÒm ‘DNAstar’ cña mét nhãm c¸c nhµ khoa häc Mü. PhÇn mÒm nµy bao gåm nhiÒu ch­¬ng tr×nh víi c¸c chøc n¨ng kh¸c nhau dïng ®Ó ph©n tÝch vµ xö lý c¸c sè liÖu trong sinh häc ph©n tö. §ã lµ: - Editseq (Peter Rahaim, c«ng ty Omni Gene) lµ ch­¬ng tr×nh ph©n tÝch, xö lý tr×nh tù nucleotid vµ axit amin. Nã cã thÓ nhËn biÕt vµ xö lý rÊt nhiÒu d¹ng sè liÖu (file) cña c¸c ch­¬ng tr×nh kh¸c nhau nh­ Text, GeneBank, FASTA, Macvector, GeneMan...Editseq ®­a ra c¸c sè liÖu vÒ DNA vµ protein. Nã cßn cã nhiÒu chøc n¨ng kh¸c nh­: bæ sung, ®¶o ng­îc sîi DNA khu«n; dÞch m· tõ tr×nh tù nucleotide sang tr×nh tù axit amin vµ ng­îc l¹i. - MapDraw (Mark Corchan, Syntro Research): dïng ®Ó lËp b¶n ®å enzim c¾t giíi h¹n. ChØ cÇn chän tr×nh tù DNA ®­a vµo (sîi ®¬n hoÆc kÐp, ë d¹ng th¼ng hoÆc vßng), ch­ong tr×nh nµy sÏ xö lý vµ cho kÕt qu¶ vÒ vÞ trÝ c¾t cïng c¸c th«ng sè cña c¸c enzim giíi h¹n; 6 tr×nh tù axit amin cña protein ®ùoc m· ho¸ tõ c¸c khung ®äc kh¸c nhau. §iÒu nµy gióp dÔ dµng chän ®­îc c¸c enzim giíi h¹n thÝch hîp cho sù nh©n dßng gen, kiÓm tra tr×nh tù c¸c ®o¹n gen ®­îc nh©n vµ biÕt ®­îc tr×nh tù axit amin ®óng cña protein ®­îc m· ho¸. - Protean (Harry Mangalam, §¹i häc California-Irvine): lµ phÇn mÒm ®Ó ph©n tÝch cÊu tróc cña protein. Nã cã thÓ dù ®o¸n vÒ cÊu tróc bËc 2, sù thay ®æi vÒ cÊu tróc vµ c¸c tÝnh chÊt ho¸ lý cña protein; gióp x¸c ®Þnh vïng kh¸ng nguyªn; dù ®o¸n kiÓu ph©n c¾t cña protein; x¸c ®Þnh nh÷ng ®ét biÕn ¶nh h­ëng lªn tÝnh chÊt cña chuçi peptid. - Megalign (William Gilbert, ViÖn Whitehead): sö dông 6 ph­¬ng ph¸p kh¸c nhau (nh­ Jotun Hein, Clustal...) ®Ó so s¸nh sù gièng vµ kh¸c nhau cña c¸c tr×nh tù nucleotid vµ c¸c acid amin. C¸c tr×nh tù nucleotid hoÆc acid amin ®­îc ®­a vµo ph©n tÝch vµ m¸y tÝnh sÏ ®­a ra kÕt qu¶ vÒ møc ®é t­¬ng ®ång cña c¸c tr×nh tù nµy d­íi d¹ng c©y ph©n lo¹i hoÆc b¶ng sè. - Genequest (Keith Joho, C«ng ty Sugen): dïng ®Ó x¸c ®Þnh vÞ trÝ khëi ®Çu vµ kÕt thóc dÞch m·; dù ®o¸n vïng m· ho¸ protein, vïng intron vµ exon. Ch­¬ng tr×nh nµy cßn x¸c ®Þnh c¸c tr×nh tù lÆp l¹i trùc tiÕp hoÆc lÆp l¹i ®¶o ng­îc; t×m kiÕm vÞ trÝ cña c¸c nh©n tè sao m·; dù ®o¸n cÊu tróc vßng cña RNA vµ DNA. - PrimerSelect ( Trevor Jowett, §¹i häc Newcastle Upon Tyne): dïng cho viÖc thiÕt kÕ vµ ph©n tÝch c¸c ®o¹n oligonucleotid bao gåm nh÷ng ®o¹n måi sö dông cho PCR, nh÷ng tr×nh tù ®o¹n dß (probe) cho lai ghÐp nhê sö dông sîi khu«n lµ DNA, RNA hoÆc tr×nh tù protein ®· ®­îc dÞch m· ng­îc. Ch­¬ng tr×nh nµy ®­a ra chi tiÕt tÝnh chÊt nhiÖt ®éng cña ®o¹n måi cho ph¶n øng kÕt cÆp; ®­a ra danh s¸ch c¸c ®o¹n måi tèi ­u cïng vÞ trÝ kÕt cÆp víi sîi khu«n cña ®o¹n måi vµ kÝch th­íc c¸c ®o¹n s¶n phÈm PCR. Nã cßn cho biÕt khung dÞch m·, vÞ trÝ c¸c enzim c¾t còng nh­ sù t¹o xo¾n (hairpin) vµ tù kÕt cÆp (primer-dimer) cña nh÷ng ®o¹n måi. 1.4.2 Internet vµ sinh häc ph©n tö Mét b­íc tiÕn nh¶y vät trong lÜnh vùc c«ng nghÖ th«ng tin lµ sù h×nh thµnh hÖ thèng internet. §ã lµ mét m¹ng kÕt nèi nhiÒu triÖu m¸y tÝnh ë kh¾p n¬i trªn thÕ giíi víi nhau vµ tõ c¸c m¸y tÝnh ®¬n lÎ cã thÓ truy cËp, khai th¸c d÷ liÖu tõ c¸c m¸y tÝnh kh¸c nhê ®­êng truyÒn c¸p quang hoÆc ®iÖn tho¹i. Do vËy, internet trë thµnh kho d÷ liÖu khæng lå. C¸c nhµ sinh häc còng ®· sö dông internet ®Ó t¹o ra c¸c trang Web vÒ sinh häc (vÝ dô nh­ trang Web: www.eib.ucv.cl cña t¹p chÝ Electrolic Journal of Biotechnology; www.emboj.org cña t¹p chÝ EMBO Journal; www.pubmed.com...) chøa ®ùng th«ng tin vÒ c¸c c«ng tr×nh khoa häc ®· ®­îc c«ng bè. Tõ c¸c m¸y tÝnh nèi m¹ng internet, ta cã thÓ cã ®­îc c¸c tµi liÖu quan t©m ®· ®­îc xuÊt b¶n khi truy cËp vµ t×m kiÕm b»ng nh÷ng tõ kho¸ nh­ tªn t¹p chÝ, tªn t¸c gi¶ hoÆc chñ ®Ò quan t©m. §Æc biÖt, c¸c nhµ sinh häc ph©n tö cßn thµnh lËp nªn c¸c ng©n hµng d÷ liÖu l­u tr÷ toµn bé c¸c tr×nh tù cña c¸c gen ®· ®­îc x¸c ®Þnh vµ tr×nh tù c¸c protein cïng víi cÊu tróc kh«ng gian cña nã. Khi truy cËp c¸c trang Web nµy chóng ta sÏ cã ®­îc tr×nh tù cña gen hoÆc cã thÓ so s¸nh c¸c tr×nh tù gen m×nh ®ang nghiªn cøu víi c¸c tr×nh tù kh¸c ®· ®­îc c«ng bè hoÆc ta còng cã thÓ ®¨ng ký vµ ®­a c¸c tr×nh tù cña m×nh vµo c¸c ng©n hµng nµy. HiÖn nay cã ba ng©n hµng d÷ liÖu chÝnh l­u tr÷ kho¶ng h¬n hai triÖu tr×nh tù ®­îc kÕt nèi víi nhau theo s¬ ®å EMBL (Europe) NCBI (USA) DDBJ (Japan) Hîp t¸c quèc tÕ Truy cËp Truy cËp Truy cËp NCBI (USA) EMBL lµ Phßng Sinh häc ph©n tö Ch©u ¢u thuéc ViÖn Th«ng tin sinh häc Ch©u ¢u cã ®Þa chØ truy cËp: www.ebi.ac.uk NCBI lµ Trung t©m th«ng tin c«ng nghÖ sinh häc quèc gia cña Mü cã ®Þa chØ truy cËp: www.ncbi.nlm.nih.gov DDBJ lµ Ng©n hµng d÷ liÖu gen NhËt B¶n thuéc Trung t©m th«ng tin sinh häc, cã ®Þa chØ truy cËp: www.ddbj.nig.ac.jp PhÇn 2 Nguyªn liÖu vµ ph­¬ng ph¸p 2.1. Nguyªn liÖu - L¸ ®u ®ñ bÞ nhiÔm virus PRSV ®· ®­îc thu thËp tõ 12 vïng trång ®u ®ñ tËp trung kh¸c nhau ë ®ång b»ng s«ng Hång, ven biÓn miÒn trung, ®ång b»ng s«ng Cöu long lµ: Hµ néi, H­ng yªn, H¶i phßng, Nam hµ, Ninh b×nh, L¹ng s¬n, NghÖ an, Nha trang, TPHCM, Long an, TiÒn giang, B×nh ®Þnh. L¸ ®­îc röa s¹ch b»ng H2O vµ ethanol sau ®ã gi÷ ë -800C ®Ó sö dông cho t¸ch ARN tæng sè. - Vector pCAMBIA2300 do tæ chøc CAMBIA, australia cung cÊp. - p2K7 plasmid do Dr. James Dale ®¹i häc Queensland, Australia cung cÊp - Vector pCR2.1, pSETA do h·ng Invitrogen cung cÊp. - C¸c ho¸ chÊt, enzim sö dông cña c¸c h·ng Sigma, Biolab, Invitrogen... 2.2. Ph­¬ng ph¸p 2.2.1. T¸ch RNA tæng sè chøa mRNA m· ho¸ protein vá cña virus PRSV Ho¸ chÊt - §Öm t¸ch RNA: Tris- HCl 200mM; EDTA 100mM; SDS 1%; Met 2% (v/v), pH 9.0 - Na – acetate 3M, pH 4.5; LiCl 8M - §Öm TE : 10 mM Tris - HCl; 1mM EDTA pH 8.0 TÊt c¶ c¸c dung dÞch ®­îc pha b»ng n­íc cÊt 2 lÇn khö ion ®· ®­îc xö lý víi DEPC 0.1% (diethyl pyrocacbonate) vµ ®­îc khö trïng Dông cô: cèi chµy sø, ®Çu c«n, èng ly t©m 50ml, eppendorf...s¹ch ®­îc ng©m trong n­íc cã 0.1% DEPC ë 370C trong 2h sau ®ã khö trïng ®èi víi ®Çu c«n, eppendorf, èng ly t©m 50ml, víi cèi chµy sø sÊy ë 1800C trong 4h. Qui tr×nh - Sö dông cèi chµy sø ®· lµm l¹nh tr­íc (ë 00C ®Õn -800C) ®Ó nghiÒn 2g l¸ bÞ nhiÔm PRSV trong nit¬ láng cho ®Õn khi l¸ nhuyÔn thµnh dÞch ®ång nhÊt. - Thªm vµo 10ml ®Öm t¸ch l¾c ®Òu. Sau ®ã thªm vµo 1V phenol : Chloroform : isoamy alcohol (tØ lÖ 25 : 24 : 1), tiÕp tôc l¾c ®Òu. - Ly t©m ë 5000 vßng/phót trong 10 phót ë 40C, thu dÞch trong chuyÓn sang tube s¹ch. - Thªm vµo 1/10V NaOAc 3M vµ 2,5V ethanol 100%, l¾c nhÑ vµ gi÷ ë –200C trong 4 giê. - Ly t©m thu tña RNA ë 14000 vßng/ phót trong 15 phót ë 40C, - Röa tña RNA b»ng ethanol 80%. Ly t©m 14000vp, 3 phót - Lµm kh« tña vµ tan trong 400 (l n­íc DEPC 0,1%. - Thªm vµo 1V LiCl 8M gi÷ ë –200C qua ®ªm - Ly t©m thu tña RNA ë 14000 vßng/ phót trong 15 phót ë 40C, - Röa tña RNA b»ng ethanol 80%. Ly t©m 14000vp, 3 phót - Lµm kh« tña vµ tan trong 400 (l n­íc DEPC 0,1%. LÊy ra 1(l ®Ó kiÓm tra chÊt l­îng trªn gel Agarose. 2.2.2 Ph­¬ng ph¸p ®iÖn di 2.2.2.1. Kü thuËt ®iÖn di ph©n tÝch DNA b»ng gel agarose Ho¸ chÊt - Agarose 0,8 - 1%; - Dung dÞch TBE 5X: Tris base 54g/l; a xÝt boric 27,5g/l; EDTE 0,5M 20 ml/l, pH 8,0 - Ethidium bromide(EtBr) 10mg/ml. - §Öm tra mÉu: 0,1 ml bromophenol blue 10%; 0,3 ml glicerol 100% vµ dÉn n­íc ®Õn 1ml. Qui tr×nh - ChuÈn bÞ gel agarose: C©n 0,8 hoÆc 1 g agarose hoµ trong 100ml dung dÞch TBE 0,5X. §un trong lß vi sãng cho agarose tan hoµn toµn (NÕu qu¸ tr×nh ®un bÞ mÊt nhiÒu n­íc th× ph¶i thªm n­íc cho ®ñ 100ml). §Ó nguéi xuèng kho¶ng 50- 60 0C , ®æ dung dÞch vµo khay gel ®iÖn di cã cµi s½n r¨ng l­îc. Sau 30 - 60 phót , khi gel agarose ®· ®«ng cøng gì khay gel vµ ®Æt vµo bÓ ®iÖn di. §æ TBE 0,5X ngËp mÆt gel ~2mm., th¸o l­îc ra khái b¶n gel. - Tra mÉu: MÉu DNA ®­îc trén víi ®Öm tra mÉu theo tØ lÖ 1V mÉu : 1V ®Öm 1X vµ nhá vµo c¸c giÕng tra mÉu trªn b¶n gel. - Ch¹y ®iÖn di: ®iÖn thÕ tõ 60 -80 V. DNA di chuyÓn tõ cùc ©m sang cù d­¬ng. Quan s¸t sù di chuyÓn b»ng mµu bromophenol blue ®Ó biÕt lóc nµo ngõng ®iÖn di. - Nhuém DNA b»ng EtBr: B¶n gel ®­îc lÊy ra khái khay vµ ng©m vµo dung dÞch EtBr 0,5 mg/l trong thêi gian kho¶ng 15 phót trªn m¸y l¾c nhÑ. Sau ®ã röa b¶n gel b»ng n­íc vµ soi d­íi ¸nh s¸ng tö ngo¹i 300nm trªn m¸y soi DNA, chôp ¶nh b»ng phim polaroit. 2.2.2.2 Ph­¬ng ph¸p ®iÖn di protein b»ng gel acrylamide Ho¸ chÊt: - Dung dÞch hçn hîp acrylamide: 30% acrylamide: 0,8%bisacrylamide - Dung dÞch ®Öm gel t¸ch: 1,5M Tris-HCl; 10% SDS, pH 8,8 - Dung dÞch ®Öm gel c«: 1M Tris-HCl; 10%SDS, pH6,8 - 10% ammonium persulfate - TEMED - §Öm tra mÉu: 50mM Tris-HCL pH6,8; 100mM dithiothreitol; 2%SDS; 1% Bromophenol blue; 10% glycerol - §Öm ®iÖn di: 25mM Tris-HCl; 250mM glycine; 0,1% SDS, pH8,5 - Dung dÞch Coomassie Brilliant Blue: 0,25g Coomassie Brilliant Blue tan trong hçn hîp 45ml metanol : 45ml H2O : 10ml axit acetic - Dung dÞch röa gel: 30% metanol : 10% axit acetic Qui tr×nh: - ChuÈn bÞ gel t¸ch 12% acrylamide: Ho¸ chÊt ®­îc lµm Êm ë nhiÖt ®é phßng vµ ®­îc trén theo thø tù trong b¶ng: Thµnh phÇn Nång ®é gel 12% (10ml/gel) H2O Dung dÞch hçn hîp acrylamide Dung dÞch ®Öm gel t¸ch Ammonium persulfate TEMED 4,55ml 3,30ml 1,25ml 100ml 5ml Trén ®Òu vµ ®æ hçn hîp gel t¸ch vµo khu«n tr¸nh t¹o bät khÝ trong gel, lÊp ®Çy bÒ mÆt b»ng n­íc cÊt vµ gi÷ nguyªn vÞ trÝ trong 30' cho gel ®«ng. Sau khi gel ®«ng, ®æ bá n­íc cÊt trªn mÆt trªn gel, thÊm kh« b»ng giÊy thÊm vµ tiÕp tôc ®æ gel c«. Hçn hîp gel c« ®­îc trén theo thø tù b¶ng sau Thµnh phÇn Nång ®é gel 5% (3ml/gel) H2O Dung dÞch hçn hîp acrylamide Dung dÞch ®Öm gel c« Ammonium persulfate TEMED 1,80ml 0,40ml 0,75ml 30ml 3ml §æ hçn hîp vµo khu«n gel bªn trªn gel t¸ch, ®Æt r¨ng l­îc tr¸nh t¹o bät vµ gi÷ nguyªn vÞ trÝ b¶n gel cho ®Õn khi gel ®«ng (kho¶ng 30'). Sau ®ã th¸o l­îc khái b¶n gel, l¾p b¶n gel vµo m¸y ®iÖn di vµ ®æ ®Çy ®Öm ®iÖn di vµ tra mÉu. MÉu ®­îc trén víi ®Öm tra mÉu theo tØ lÖ 1:1 vµ ®­îc tra vµo giÕng tra mÉu b»ng sylanh. M¸y ®iÖn di ®­îc nèi víi nguån ®iÖn víi hiÖu ®iÖn thÕ ~60-80V, cho ®Õn khi v¹ch mÇu di chuyÓn gÇn hÕt b¶n gel (kho¶ng 90'). Th¸o gel khái khu«n vµ ®Æt vµo dung dÞch nhuém l¾c nhÑ trong 4h ë nhiÖt ®é phßng LÊy gel khái dÞch nhuém vµ l¾c röa trong dung dÞch röa cho ®Õn khi b¶n gel trë lªn tr¾ng. LÊy gel quan s¸t vµ chôp ¶nh 2.2.3. ThiÕt kÕ Primer: §Ó thiÕt kÕ primer, 20 tr×nh tù acid amin cña c¸c coat protein kh¸c nhau ®· ®­îc s­u tËp tõ ng©n hµng SWISS-PROT cña trang Web: www.ncbi.nlm.nih.gov trªn m¹ng internet. C¸c tr×nh tù nµy ®­îc so s¸nh víi nhau b»ng ch­¬ng tr×nh Megalign cña phÇn mÒm DNAstar. §o¹n tr×nh tù acid amin gièng nhau nhÊt vÒ phÝa hai ®Çu cña c¸c protein ®· ®­îc chän vµ chuyÓn thµnh tr×nh tù c¸c nucleotid ®Ó sö dông lµm primer. 2.2.4. Ph­¬ng ph¸p RT-PCR Ho¸ chÊt: - MuLV reverse Transcriptase 50U/l - RNase Inhibitor 20U/(l - Oligo d(T)16 50(M ( poly T lµm ®o¹n måi ®Ó sao m· ng­îc) - dNTP 10mM (mçi lo¹i) - Taq DNA polymerase 5U/(l - Primer: sö dông c¸c primer kh¸c nhau víi nång ®é gèc 25pmol - 10X PCR buffer, MgCl2 25mM - DÞch RNA tæng sè ®¶m b¶o chÊt l­îng. TÊt c¶ c¸c ho¸ chÊt ®­îc gi÷ ë -200C cho ®Õn khi sö dông. Qui tr×nh: + Tæng hîp sîi khu«n thø nhÊt cña ®o¹n cDNA: hçn hîp ph¶n øng ®­îc chuÈn bÞ theo tr×nh tù cña b¶ng sau: Thµnh phÇn ph¶n øng ThÓ tÝch (20ml) Nång ®é cuèi Dung dÞch MgCl2 §Öm PCR 10X N­íc ®· xö lý DEPC dNTP Rnase inhibitor Oligo dT RNA tæng sè MuLV reverse Transcriptase 4 2 2 2( mçi lo¹i) 1 1 1 1 5mM 1X - 1mM 1U/ml 2,5mM ~1mg 2,5U/(ml) Ph¶n øng ®­îc thùc hiÖn theo chu kú nhiÖt: 420C trong 2h; 950C trong 5' vµ 50C trong 5'. S¶n phÈm ®­îc sö dông cho ph¶n øng tiÕp theo lµ khuÕch ®¹i ®o¹n cDNA. T + KhuÕch ®¹i ®o¹n cDNA: hçn hîp ph¶n øng ®­îc chuÈn bÞ theo tr×nh tù cña b¶ng sau: Thµnh phÇn ph¶n øng ThÓ tÝch (100ml) Nång ®é cuèi Dung dÞch MgCl2 §Öm PCR 10X N­íc khö ion Måi 1 Måi 2 Taq DNA polymerase Sîi ®¬n cDNA (míi tæng hîp) 4 8 57.5 5 5 0,5 20 2mM 1X - 1,25pmol 1,25pmol 2,5U/100ml Ph¶n øng ®­îc thùc hiÖn theo chu kú nhiÖt: 940C trong 5'; (940C trong 1'; 550C trong 1'; 720C trong 1', lÆp l¹i 35 vßng) vµ 720C trong 10'. 2.2.5. Ph­¬ng ph¸p t¸ch vµ tinh s¹ch DNA tõ gel Agarose b»ng ly t©m - AND sau khi ®­îc ph©n t¸ch b»ng ph­¬ng ph¸p ®iÖn di trªn gel agarose, b¶n gel ®­îc nhuém víi EtBr trong 15’ vµ ®­îc soi d­íi ®Ìn UV x¸c ®Þnh ®o¹n DNA cÇn t¸ch. Dïng dao nhän c¾t phÇn gel chøa ®o¹n DNA cÇn t¸ch ®­a vµo èng tube ®­îc thiÕt kÕ nh­ sau: - Ly t©m ë 13500 v/p trong 5', thu dÞch trong tube 1,5ml chuyÓn sang tube kh¸c. - Thªm: - 0,1V NaOAc 5M (HoÆc 0,2V NH4OAc 10M). - 2ml LPA 0,25% (liner polyacrylamide) - 2V EtOH; §Æt ë -200C trong 15' - Ly t©m 13500v/p trong 15 phót ë 40C - Thu kÕt tña vµ röa b»ng etanol 70%. Lµm kh« b»ng speed vaccum - Tan tña trong 20ml TE gi÷ ë 40C 2.2.5. Ph¶n øng ghÐp nèi ®o¹n gen víi vector §o¹n DNA cÇn nèi ghÐp vµ vector ®· më vßng ®­îc trén lÉn víi nhau theo tû lÖ 3:1 vÒ sè l­îng ph©n tö. L­îng DNA cÇn nèi th­êng ®­îc tÝnh theo c«ng thøc Sè ng DNA = ChiÒu dµi ®o¹n DNA (bp). X ng vector KÝch th­íc vector (bp) Trong ®ã víi kÝch th­íc vector xÊp xØ 4000bp th× l­îng vector th­êng dïng lµ X = 50 ng. T4 ligase ®­îc cho vµo ph¶n øng víi nång ®é 2 ®¬n vÞ/ 10ml ph¶n øng. Hçn hîp ph¶n øng ®­îc trén theo thø tù ddH2O 5 ml §Öm T4 ligase x10 2 ml §o¹n gen cÇn g¾n 1 ml Vector ®· më vßng 1 ml T4 ligase (4 ®¬n vÞ/ml) 0,5 ml S thÓ tÝch 10 ml Ph¶n øng ®­îc ñ qua ®ªm ë 12-160C hoÆc ñ 40C trong 24h. §Öm lai (10X): 200mM Tris- HCl; 50mM MgCl2; 50mM dithiothreitol; 500 mg/ml BSA, pH=7,6 2.2.6. Ph­¬ng ph¸p xö lý víi enzim giíi h¹n vµ Mung-bean nuclease C¸c vector t¸i tæ hîp ®­îc xö lý víi enzim giíi h¹n theo c¸c ph¶n øng: + Xö lý víi mét enzim: Hçn hîp ph¶n øng ®­îc trén theo thø tù H20 (30 -x - 3,5) ml §Öm 10X riªng cña enzim 3 ml DÞch plasmid x ml (~1mg) Enzim (10U/ml) 0,5ml Tæng thÓ tÝch ph¶n øng 30ml + Xö lý víi hai enzim: Hçn hîp ph¶n øng ®­îc trén theo thø tù H20 (30 -x - 3,5) ml §Öm 10X chung tèi ­u cho hai enzim 3 ml DÞch plasmid x ml (~1mg) Enzim 1 (10U/ml) 0,5 ml Enzim 2 (10U/ml) 0,5 ml Tæng thÓ tÝch ph¶n øng 30 ml Ph¶n øng ®­îc ñ ë 370C qua ®ªm vµ s¶n phÈm c¾t ®­îc kiÓm tra b»ng ®iÖn di trªn gel agarose 1%. + Xö lý víi Mung-Bean nuclease Vector pRSETA vµ c¸c ®o¹n gen PRSVN sau khi ®­îc c¾t b»ng enzim giíi h¹n cã ®Çu dÝnh ®­îc xö lý t¹o ®Çu b»ng víi enzim Mung-Bean nuclease b»ng ph¶n øng: H20 16 ml §Öm 10X 3 ml DÞch plasmid pRSETA hoÆc ®o¹n gen PRSVN 10 ml (~1mg) Enzim Mung-bean (3,9U/ml) 1 ml Tæng thÓ tÝch ph¶n øng 30 ml Ph¶n øng ®­îc ñ ë nhiÖt ®é phßng trong 15' vµ s¶n phÈm c¾t ®­îc kiÓm tra b»ng ®iÖn di trªn gel agarose 1%. 2.2.7. Ph­¬ng ph¸p biÕn n¹p 2.2.7.1 BiÕn n¹p vµo E. coli + ChuÈn bÞ tÕ bµo kh¶ biÕn: - LÊy mét khuÈn l¹c E. coli (DH 5a) nu«i trong 10 ml LB láng ë 370C qua ®ªm, l¾c 250v/p. - Hót 0,5ml dÞch tÕ bµo cho vµo 50ml LB láng nu«i trong 4h ë 370C, l¾c 250v/p. - Thu dÞch tÕ bµo lµm l¹nh trong ®¸ 10' - Ly t©m 4000v/p ë 40C trong 5', thu kÕt tña. - Tan tña tÕ bµo trong 5ml CaCl2 0,1M ( ®Ó l¹nh s½n ë 00C), ly t©m thu tña. - Tan tña tÕ bµo trong 0,85ml CaCl2 0,1M ( ®Ó l¹nh s½n ë 00C) vµ 0,15 ml glycerol , chia nhá 200m1 vµo èng eppendof - Lµm l¹nh nhanh trong N2 láng, gi÷ ë -850C. + BiÕn n¹p: - gi÷ Êm èng ®ùng tÕ bµo kh¶ biÕn cho tan b¨ng vµ ®Æt ngay vµo ®¸. - Thªm ~50ng dung dÞch plasmid vµo èng tÕ bµo, ñ 30' trong ®¸. - Sèc nhiÖt ë 420C trong 90'', chuyÓn sang n­íc ®¸ 2'-3'. - Trén thªm 800m1 dung dÞch SOC ñ 1h ë 370C. - Hót 50m1 vµ 100m1 dÞch tÕ bµo cÊy tr¶i trªn m«i tr­êng LB ®Æc bæ sung 50mg/l Kanamixin, ®Æt qua ®ªm ë 370C vµ chän läc khuÈn l¹c ®­îc biÕn n¹p 2.2.7.2 BiÕn n¹p vµo agrobacterium + ChuÈn bÞ tÕ bµo kh¶ biÕn: - LÊy mét khuÈn l¹c agrobacterium nu«i trong 10 ml LB láng ë 290C qua ®ªm, l¾c 250v/p. - Hót 4ml dÞch tÕ bµo cho vµo 100ml LB láng nu«i trong 4h ë 290C, l¾c 250v/p. - Ly t©m 4000v/p ë 40C trong 5', thu kÕt tña. - Tan tña tÕ bµo trong 0,85ml m«i tr­êng LB láng vµ 0,15 ml glycerol , chia nhá 200m1 vµo èng eppendof - Lµm l¹nh nhanh trong N2 láng, gi÷ ë -850C. + BiÕn n¹p: - gi÷ Êm èng ®ùng tÕ bµo kh¶ biÕn cho tan b¨ng vµ ®Æt ngay vµo ®¸. - Thªm ~50ng dung dÞch plasmid vµo èng tÕ bµo, lµm l¹nh nhanh trong N2 láng - Sèc nhiÖt ë 370C trong 5 phót. - Trén thªm 800m1 dung dÞch SOC ñ 2h ë 280C. - Hót 50m1 vµ 100m1 dÞch tÕ bµo cÊy tr¶i trªn m«i tr­êng LB ®Æc bæ sung 50mg/l Kanamycin, ®Æt ë 280C tõ hai ®Õn ba ngµy vµ chän läc khuÈn l¹c ®­îc biÕn n¹p. LB: 10g/l Trypton; 10 g/l NaCl; 5g/l extrac yeast, pH 7,0 SOC: 20g/l Trypton; 5g/l extrac yeast; 0,5g/l NaCl; 10ml/l KCl 0,25M vµ 5ml/l MgCl2 2M; pH 7,0 2.2.8. KiÓm tra khuÈn l¹c chøa vector t¸i tæ hîp b»ng PCR - LÊy mét phÇn khuÈn l¹c chuyÓn vµo èng Eppendorf cã chøa s½n 45ml ddH2O khö trïng. §un s«i trong 5 phót. - Ly t©m nhanh, chuyÓn 41,75 ml sang èng Eppendorf 0,5 ml cã chøa s½n c¸c thµnh phÇn cho ph¶n øng PCR: dNTP(10mM) 1 ml §Öm PCR x10 5 ml Måi 1 1 ml Måi 2 1 ml Taq polymerase 0,25 ml S thÓ tÝch 8,25 ml - Chu tr×nh nhiÖt lµ: 940C: 1 phót; (940C: 1 phót, 560C: 1 phót, 720C: 1 phót 20 gi©y) lÆp l¹i 25 chu kú; 720C: 10 phót. - KiÓm tra s¶n phÈm ph¶n øng PCR trªn gel agarose 1%, (15 ml/mÉu). 2.2.9. T¸ch chiÕt DNA plasmid tõ E. coli Ho¸ chÊt - Dung dÞch I: glucose 50mM; Tris-HCl 25mM, EDTA 10mM, pH 8,0 - Dung dÞch II: NaOH 0,2N; SDS 1% - Dung dÞch III: 60ml Potassium acetat 5M : 11,5ml axit acetic : 28,5ml H2O - Natri acetat 3M pH 5,2 Qui tr×nh - CÊy chuyÓn mét khuÈn l¹c vµo trong èng nghiÖm chøa 3 ml m«i tr­êng LB cã bæ sung kh¸ng sinh chän läc, nu«i cÊy l¾c qua ®ªm ë 370C, 200 vßng/phót. - ChuyÓn 1,5 ml dÞch nu«i cÊy vµo trong èng Eppendorf lo¹i 1,5 ml vµ ®em ly t©m 6000 vßng/phót, 6 phót ®Ó thu tÕ bµo. Lo¹i bá dÞch næi. - CÆn ®­îc hoµ trong 100 ml dung dÞch I b»ng m¸y vortex. - Bæ sung ngay 200 ml dung dÞch II. §¶o èng Eppendorf nhÑ nhµng, gi÷ trong 5 phót. Hçn hîp trë nªn trong suèt vµ qu¸nh. - Bæ sung tiÕp 150 ml dung dÞch III vµ ®¶o nhÑ nhµng, gi÷ trong 3 phót. Trong hçn hîp sÏ xuÊt hiÖn kÕt tña tr¾ng. - §em ly t©m 10 phót ë tèc ®é 10000 vßng/phót. - ChuyÓn dÞch næi sang èng Eppendorf míi. Bæ sung 450 dung dÞch Phenol/Chloroform/Isoamyl Alcohol (25:24:1), trén thËt ®Òu vµ ®em ly t©m 10000 vßng/phót, 15 phót ®Ó lo¹i protein vµ DNA nhiÔm s¾c thÓ. - Hót nhÑ nhµng pha trªn sang èng Eppendorf moi vµ lÆp l¹i b­íc trªn víi 400 ml dung dÞch hçn hîp Chloroform: Isoamyl Alcohol (24:1) ®Ó lo¹i bá l­îng nhá phenol cßn sãt l¹i khái dung dÞch DNA plasmid. - Hót nhÑ nhµng pha trªn sang èng Eppendorf míi (tr¸nh lµm vÈn pha d­íi). Tña dÞch thu ®­îc víi 2 lÇn thÓ tÝch cån tuyÖt ®èi cã thªm dung dÞch muèi Natri axetat tíi nång ®é cuèi cïng 0,3 M. §Ó dung dÞch DNA kÕt tña ë -200C qua ®ªm hoÆc ë -750C trong 2 giê. - Thu DNA kÕt tña trong dung dÞch b»ng c¸ch ®em ly t©m 14000 vßng/phót trong 15 phót ë 40C. PhÇn kÕt tña ®­îc röa víi cån 700C vµ thu l¹i b»ng c¸ch ly t©m 14000 vßng/phót ë trong 10 phót. - Hoµ tan DNA thu ®­îc vµo trong 30ml dung dÞch TE hoÆc n­íc cÊt hai lÇn khö trïng. Gi÷ trong -200C. - Ch¹y ®iÖn di kiÓm tra trªn gel agarose 0,8%. 2.2.10. Ph©n tÝch tr×nh tù nucleotide - pCR2.1-TA vector cã chøa ®o¹n gen CP sau khi ®· tinh s¹ch ®­îc ®äc tr×nh tù gen trªn m¸y ®äc tù ®éng, sö dông cÆp måi ®äc tr×nh tù lµ M13 forward vµ reverse. KÕt qu¶ ®­îc ph©n tÝch trªn m¸y tÝnh, sö dông ch­¬ng tr×nh phÇn mÒm DNAstar. Tõ ch­¬ng tr×nh nµy tiÕn hµnh: + So s¸nh c¸c tr×nh tù nèi ghÐp ®o¹n gen ®­îc ®äc tõ hai ®Çu forward vµ reverse. + X¸c ®Þnh ®­îc vÞ trÝ, sè l­îng c¸c enzyme giíi h¹n trªn tr×nh tù DNA. + Phiªn m· tr×nh tù nucleotide sang tr×nh tù amino acid theo mét trong c¸c khung ®äc më. - Tr×nh tù nucleotide ®­îc so s¸nh víi tr×nh tù nucleotide cña c¸c gen CP kh¸c trong ng©n hµng gen trªn trang Web: www.ncbi.nlm.nih.gov b»ng ch­¬ng tr×nh EMBL FASTA. 2.2.11 ThiÕt kÕ vector chuyÓn gen mang gen PRSVN Gen PRSVN vµ vector p2K7 ®­îc c¾t b»ng hai enzim Sac I vµ Xba I, ®­îc tinh s¹ch b»ng ®iÖn di trªn gel agarose. Gen PRSVN ®­îc chÌn vµo vector p2K7 ®Ó g¾n víi 35S promoter vµ Nos terminater b»ng T4 ligase. Vector t¸i tæ hîp nµy ®­îc biÕn n¹p vµo E.coli Top10F'. CÊu tróc 35S pro - gen PRSVN - Nos ter ®­îc c¾t ra b»ng Hind III vµ Kpn I vµ ®­a vµo vector chuyÓn gen pCAMBIA2300 ®· ®­îc mí vßng còng b»ng hai enzim Hind III vµ KpnI. Vector t¸i tæ hîp cña b­íc nµy ®­îc biÕn n¹p vµo chñng vi khuÈn Agrobacterium LBA4404. C¸c khuÈn l¹c ®­îc chän läc b»ng kanamycin vµ kh¼ng ®Þnh b»ng ph¶n øng PCR. 2.2.12. BiÓu hiÖn gen CP trong E.coli Gen PRSVN ®­îc ®­a vµo vector biÓu hiÖn pRSETA b»ng ba b­íc: - §Çu tiªn pRSETA ®­îc më vßng b»ng enzim Pst I vµ p2300-PRSVN ®­îc më b»ng enzim Xba I. Sau ®ã, ®o¹n gen vµ vector nµy ®­îc xö lý t¹o ®Çu b»ng víi enzim Mung Bean, tiÕp theo lµ c¾t víi enzim Nco I. §o¹n gen PRSVN ®­îc g¾n vµo pRSETA b»ng T4 ligase vµ ®­îc biÕn n¹p vµo chñng E.coli BL21(DE3). Chñng E.coli BL21(DE3) mang plasmid t¸i tæ hîp pRSETA-PRSVN ®­îc nu«i trong 2ml m«i tr­êng LB qua ®ªm. Sau ®ã lÊy ra 0,25 ml dÞch nu«i cÊy tiÕp tôc nu«i trong 25ml LB. Sau 2 giê, kiÓm tra OD (kho¶ng 0,3-0,5), thªm IPTG vµo m«i tr­êng (nång ®é cuèi cïng lµ 0.5mM), tiÕp tôc nu«i qua ®ªm vµ thu sinh khèi tÕ bµo. Tña tÕ bµo ®­îc hoµ tan trong ®Öm vµ ®un s«i trong 5'. Sau ®ã Protein tæng sè ®­îc ph©n tÝch b»ng ®iÖn di gel acrylamide 12%. 2.2.13. Western blotting Protein tæng sè ph©n tÝch trªn gel acrylamide ®­îc chuyÓn sang mµng nitrocellulo PVDF b»ng ®iÖn di ë 60V trong 1 giê. Mµng ®­îc ñ trong ®Öm s÷a trong 2h ë 250C hoÆc ñ qua ®ªm ë 40C. TiÕp theo ®ã lµ ñ víi dung dÞch pha lo·ng cña kh¸ng thÓ ®a dßng kh¸ng Protein vá (CP) trong 2h ë nhiÖt ®é phßng. Röa mµng 3 lÇn mçi lÇn 10' trong ®Öm s÷a ®Ó lo¹i bá kh¸ng thÓ d­ thõa ñ tiÕp víi kh¸ng thÓ thø hai ®· ®­îc liªn kÕt víi alkaline photphatase trong 1h ë nhiÖt ®é phßng Röa mµng 3 lÇn mçi lÇn 10' trong ®Öm s÷a V¹ch protein ®­îc ph¸t hiÖn b»ng nhuém mµng trong dung dÞch nhuém, quan s¸t mµu. ngõng ph¶n øng nhuém b»ng röa mµng víi n­íc. §Öm s÷a: 20mM Tris; 180mM NaCl; 0,2% Muèi azide; 0,4% Marvel; pH 7,8 Dung dÞch nhuém: 100mM Tris; 100mM NaCl; 5mM MgCl2; 75mg/ml BCIP; 150mg/ml NBT; pH 8,9 PhÇn 3 KÕt qu¶ vµ th¶o luËn 3.1. T¸ch ARN tæng sè 1 ml dÞch ARN ®· ®­îc lÊy ®iÖn di trªn gel agarose 1% ®Ó kiÓm tra chÊt l­îng vµ hµm l­îng ARN. ¶nh ®iÖn di (¶nh 1) cho ta thÊy r»ng b¨ng v¹ch ARN t¸ch ®­îc râ rµng vµ ®Ëm víi kÝch th­íc t­¬ng øng víi c¸c lo¹i ARN kh¸c nhau lµ 5S, 16S vµ 28S . Nh­ vËy chÊt l­îng ARN lµ rÊt tinh s¹ch kh«ng bÞ ph©n c¾t vµ cã nång ®é cao ®¸p øng ®­îc cho c¸c thÝ nghiÖm tiÕp theo. ¶nh 1: ARN tæng sè cã chøa ARN cña PRSV t¸ch tõ l¸ ®u ®ñ nhiÔm PRSV ë c¸c vïng kh¸c nhau cña ViÖt Nam (gel agarose 1%) 3.2. ThiÕt kÕ primer 3.2 X¸c ®Þnh ®iÒu kiÖn tèi ­u cho ph¶n øng PCR Ph­¬ng ph¸p gradien nång ®é nhiÖt ®é kÕt cÆp b»ng m¸y Mastercycle gradien ®· ®­îc sö dông ®Ó x¸c ®Þnh nhiÖt ®é kÕt cÆp tèi ­u ®èi víi c¸c primer thiÕt kÕ. Gradien nhiÖt ®é kÕt cÆp gåm: 46.6; 50,8; 56,6; 61,8; 650C. Chu tr×nh nhiÖt lµ 940C trong 5'; { 940C trong 1', gradien nhiÖt ®é kÕt cÆp trong 1', 720C trong 1'} lÆp l¹i 35 vßng; 720C trong 10' víi ADN khu«n mÉu lµ 10ml cDNA sîi ®¬n tõ ph¶n øng sao m· ng­îc. S¶n phÈm PCR ®­îc ph©n tÝch trªn gel agarose 1% (¶nh2) cho thÊy cã 4 cÆp primer ®· nh©n lªn ®­îc ®o¹n gen CP v¬Ý kÝch th­íc ®óng nh­ lý thuyÕt lµ kho¶ng 780bp ®Õn 850 bp cïng ®é nh¹y kh¸c nhau nh­ng nh¹y nhÊt lµ cÆp primer V (nh2-nh5). Do vËy chóng t«i ®· chän cÆp nµy víi nhiÖt ®é kÕt cÆp lµ 550C cïng víi cÆp MB11-MB12 ®Ó sµng läc PRSV tõ c¸c mÉu thu ë ViÖt Nam ¶nh 2: kÕt qu¶ nh©n ®o¹n gen CP víi gradien nhiÖt ®é kÕt cÆp vµ c¸c cÆp primer kh¸c nhau M: Marker 1Kb I: Gen CP ®­îc nh©n víi NH1&NH4 primers VI: Gen CP ®­îc nh©n víi NH1&NH6 primers II: Gen CP ®­îc nh©n víi NH1&NH5 primers VII: Gen CP ®­îc nh©n víi NH3&NH4 primers III: Gen CP ®­îc nh©n víi NH1&NH6 primers VIII: Gen CP ®­îc nh©n víi NH3&NH5 primers IV: Gen CP ®­îc nh©n víi NH2&NH4 primers IX: Gen CP ®­îc nh©n víi NH3&NH6 primers V: Gen CP ®­îc nh©n víi NH2&NH5 primers Lane 1...5: c¸c nhiÖt ®é kÕt cÆp kh¸c nhau 46.6; 50.8; 56.6; 61.8; 650C. 3.3. Sµng läc gen CP cña PRSV tõ c¸c mÉu l¸ ®u ®ñ nhiÔm PRSV ë ViÖt Nam: KÕt qu¶ sµng läc (¶nh 3) b»ng ph­¬ng ph¸p RT-PCR ®· cho thÊy r»ng chØ cã mét ®o¹n gen CP duy nhÊt ®­îc nh©n lªn víi tÊt c¶ c¸c mÉu nhiÔm PRSV ®­îc sµng läc. KÕt qu¶ nµy lÆp l¹i khi sö dông hai cÆp primer MB11-MB12 vµ nh2-nh5. §iÒu nµy cã thÓ ®­îc kh¼ng ®Þnh r»ng gen CP cña PRSV ë ViÖt Nam cã cïng mét kÝch th­íc vµ nh­ vËy cã thÓ chóng lµ cïng mét chñng PRSV. ¶nh 3: KÕt qu¶ sµng läc c¸c mÉu PRSV cña ViÖt Nam Gen CP ®­îc nh©n b»ng cÆp primer MB11-MB12 (tr¸i) vµ NH2-NH5 (ph¶i) Dßng M: Marker 1Kb Dßng 1...13: MÉu nhiÔm PRSV cña Viªt Nam; dßng 14: MÉu kh«ng nhiÔm PRSV cña Malaysia 3.4. Ph©n tÝch tr×nh tù gen CP §o¹n gen CP sau khi ®­îc nh©n lªn víi hai cÆp primer MB11-MB12 vµ NH2-NH5 ®­îc ®­a vµo vector pCR2.1. Vector t¸i tæ hîp nµy ®­îc tinh s¹ch vµ ®äc tr×nh tù. Chóng t«i ®· nhËn ®­îc kÕt qu¶ Tr×nh tù nucleotide cña gen PRSVN (gen CP) ®­îc nh©n b»ng cÆp primer MB11-MB12 GTCTAGATGTCCAAAACTGAAGCTGTGGATGCTGGTCTGAATGAAAAGCTAAAAGAAAAG 60 GAAAAACAGAAAGAAAAAGAAAAAGAAAAAGATAAACAAAAAGATAAAGATAATGATGGA GCTAGTGACGGAAATGATGTGTCAACTAGCACAAAAACTGGAGAGAGAGATAGAGATGTC 180 AACGCCGGAACTAGTGGAACTTTCACTGTTCCAAGGATAAAGTCTTTTACTGATAAGATG ATTTTACCAAGAATTAAGGGAAAGTCTGTCCTTAATTTAAATCATCTTCTTCAGTATAAT 300 CCGAAACAAATTGACATCTCAAACACTCGTGCCACTCAATCTCAATTTGAAAAGTGGTAT GAGGGAGTGAGGAATGATTATGGTCTTAGTGATAACGAAATGCAAGTGATGTTAAATGGT 420 TTGATGGTTTGGTGTATCGAAAATGGTACATCTCCAGACATATCTGGTGTTTGGGTAATG ATGGATGGGGAAACCCAGGTTGATTATCCTATCAAACCTTTAATTGAACATGCAACTCCT 540 TCATTTAGGCAAATCATGGCTCACTTCAGTAACGCGGCAGAGGCATATATCGCGAAGAGA AATGCAACTGAGAGGTACATGCCGCGGTATGGAATTAAAAGGAATTTGACTGACATTAGC 660 CTCGCTCGATATGCTTTTGATTTCTATGAGGTGAACTCGAAAACACCTGATGGGGCTCGT GAAGCTCATATGCAGATGAAGGCTGCAGCGCTACGTAATACTAGTCGCAGAATGTTCGGA 780 ATGGACGGCAGTGTCAGTAACAAGGAAGAAAACACGGAGAGACACACAGTGGAAGATGTC AATAGAGACATGCACTCTCTCCTGGGTATGCGCAATTAAATACTCGCACTTGTGTGTTTG 900 GAGCTCC 907 Tr×nh tù a xÝt amin dÞch m· tõ gen PRSVN V.MSKTEAVDAGLNEKLKEKEKQKEKEKEKDKQKDKDNDGASDGNDVSTSTKTGERDRDV 60 NAGTSGTFTVPRIKSFTDKMILPRIKGKSVLNLNHLLQYNPKQIDISNTRATQSQFEKWY 120 EGVRNDYGLSDNEMQVMLNGLMVWCIENGTSPDISGVWVMMDGETQVDYPIKPLIEHATP 180 SFRQIMAHFSNAAEAYIAKRNATERYMPRYGIKRNLTDISLARYAFDFYEVNSKTPDGAR 240 EAHMQMKAAALRNTSRRMFGMDGSVSNKEENTERHTVEDVNRDMHSLLGMRN.ILALVCL 300 EL 302 Tr×nh tù nucleotide cña gen nh2nh5 (gen CP) ®­îc nh©n b»ng cÆp primer NH2-NH5 GAGAAGCTGAAGGAGAAGGAGAAGCAGAAAGAAAAAGAAAAAGAAAAAGATAAACAAAAA 60 GATAAAGATAATGATGGAGCTAGTGACGGAAATGATGTGTCAACTAGCACAAAAACTGGA GAGAGAGATAGAGATGTCAACGCCGGAACTAGTGGAACTTTCACTGTTCCAAGGATAAAG 120 TCTTTTACTGATAAGATGATTTTACCAAGAATTAAGGGAAAGTCTGTCCTTAATTTAAAT CATCTTCTTCAGTATAATCCGAAACAAATTGACATCTCAAACACTCGTGCCACTCAATCT 300 CAATTTGAAAAGTGGTATGAGGGAGTGAGGAATGATTATGGTCTTAGTGATAACGAAATG CAAGTGATGTTAAATGGTTTGATGGTTTGGTGTATCGAAAATGGTACATCTCCAGACATA 420 TCTGGTGTTTGGGTAATGATGGATGGGGAAACCCAGGTTGATTATCCTATCAAACCTTTA ATTGAACATGCAACTCCTTCATTTAGGCAAATCATGGCTCACTTCAGTAACGCGGCAGAG 540 GCATATATCGCGAAGAGAAATGCAACTGAGAGGTACATGCCGCGGTATGGAATTAAAAGG AATTTGACTGACATTAGCCTCGCTCGATATGCTTTTGATTTCTATGAGGTGAACTCGAAA 660 ACACCTGATAGGGCTCGTGAAGCTCATATGCAGATGAAGCTGCAGCGCTACGTAATACTA GTCGCAGAATGTTCGGAATGGACCGCAGTGTCAGTAACCAGGGAAGAAAACACCGAAAGA 780 A 781 Tr×nh tù a xÝt amin dÞch m· tõ gen nh2nh5 EKLKEKEKQKEKEKEKDKQKDKDNDGASDGNDVSTSTKTGERDRDVNAGTSGTFTVPRIK 60 SFTDKMILPRIKGKSVLNLNHLLQYNPKQIDISNTRATQSQFEKWYEGVRNDYGLSDNEM 120 QVMLNGLMVWCIENGTSPDISGVWVMMDGETQVDYPIKPLIEHATPSFRQIMAHFSNAAE 180 AYIAKRNATERYMPRYGIKRNLTDISLARYAFDFYEVNSKTPDRAREAHMQMKLQRYVIL 240 VAECSEWTAVSVTREENTER 260 Sö dông ch­¬ng tr×nh Aligment cña phÇn mÒm DNAstar ®Ó so s¸nh tr×nh tù gen CP ®­îc nh©n lªn b»ng hai cÆp primer kh¸c nhau. KÕt qu¶ so s¸nh cho thÊy hai tr×nh tù nµy lµ t­¬ng ®ång nhau (gièng nhau ~98%). Hai tr×nh tù nµy còng ®­îc so s¸nh víi c¸c tr×nh tù gen CP kh¸c trong ng©n hµng gen cña trang Web: www.ncbi.nlm.nih.gov trªn m¹ng internet. KÕt qu¶ møc ®é gièng nhau ®¹t tõ 87,6 % ®Õn 96,8%. V× tr×nh tù c¸c nucleotide cña PRSVN vµ nh2nh5 t­¬ng ®ång nhau nh­ng do tr×nh tù cña PRSVN (907 bp) dµi h¬n tr×nh tù cña nh2nh5 (781 bp) vµ cã ®iÓm c¾t cña enzim Xba I vµ Sac I ë hai ®Çu mót (trong tr×nh tù cña primer) thuËn tiÖn h¬n cho viÖc g¾n vµo c¸c vector nªn chóng t«i ®· chän ®o¹n gen PRSVN cho thÝ nghiÖm tiÕp theo. 3.5. KiÓm tra gen PRSVN nhËn ®­îc b»ng PCR nh©n lªn ®o¹n ®Æc hiÖu cña gen CP Ba cÆp primer ®Æc hiÖu cho gen CP cña PRSV ®· ®­îc sö dông. KÕt qu¶ lµ víi cÆp primer 10U&10L ®· nh©n lªn ®­îc ®o¹n ADN kho¶ng 550bp ë c¶ hai gen PRSVN tõ PRSV cña ViÖt Nam vµ CP tõ PRSV cña Malaysia. Nh­ vËy, chóng t«i cã thÓ kh¼ng ®Þnh lµ gen PRSVN ®óng lµ CP cña PRSV. ¶nh 4: KiÓm tra gen PRSVN nhËn ®­îc b»ng PCR nh©n lªn ®o¹n ®Æc hiÖu cña gen CP M: marker 1Kb Dßng 1: §o¹n ADN ®Æc hiÖu ®­îc nh©n b»ng 1U & 1L primer Dßng 2: §o¹n ADN ®Æc hiÖu ®­îc nh©n b»ng 3U & 3L primer Dßng 3: §o¹n ADN ®Æc hiÖu ®­îc nh©n b»ng 10U & 10L primer A: ADN khu«n mÉu lµ gen PRSVN tõ PRSV cña Vietnam B: ADN khu«n mÉu lµ gen CP tõ PRSV cña Malaysia Dßng 7: §èi chøng d­¬ng víi MB11 & MB12 primer. 3.6 KiÓm tra tr×nh tù gen PRSVN nhËn ®­îc b»ng c¾t víi c¸c enzim giíi h¹n sö dông ch­¬ng tr×nh Mapdraw cña phÇn mÒm DNAstar ®Ó ph©n tÝch b¶n ®å enzim c¾t h¹n chÕ cña gen PRSVN. Tr×nh tù gen PRSVN chøa h¬n 140 vÞ trÝ nhËn biÕt cña c¸c enzim kh¸c nhau. Nh­ng chóng t«i chØ chän mét sè enzim Xba I (2), Dra I (278), Nru I (592), Nde I (728), Ban II (717, 905) and Sac I (905) ®Ó kiÓm tra sù chÝnh x¸c cña tr×nh tù gen nhËn ®­îc. ¶nh 5: KiÓm tra tr×nh tù gen PRSVN nhËn ®­îc b»ng c¾t víi c¸c enzim giíi h¹n Dßng M: Marker 1Kb Dßng 1: pCR2.1-PRSVN ®­îc c¸t víi Xba I & Sac I Dßng 2: pCR2.1-PRSVN ®­îc c¸t víi Dra I & Sac I Dßng 3: pCR2.1-PRSVN ®­îc c¸t víi Xba I & Ban II Dßng 4: pCR2.1-PRSVN ®­îc c¸t víi Xba I & Nde I Dßng 5: pCR2.1-PRSVN kh«ng c¾t ë dßng 1, b¨ng ADN ~900bp ®· quan s¸t ®­îc. §ã lµ b¨ng ADN cña gen PRSVN. Trong c¸c dßng 2, 3, 4 c¸c b¨ng ADN kh¸c nhau còng ®· nhËn ®­îc t­¬ng øng víi kÝch thø¬c ~630bp, ~715bp vµ ~725bp. C¸c b¨ng nµy ®­îc c¾t tõ gen PRSVN theo ®óng nh­ tr×nh tù gen qui ®Þnh. §iÒu nµy chøng tá tr×nh tù gen nhËn ®­îc lµ chÝnh x¸c. 3.7 ThiÕt kÕ vector chuyÓn gen mang gen PRSVN Tr­íc tiªn gen PRSVN ®­îc t¸ch b»ng c¾t víi hai enzim Xba I vµ Sac I, råi ®­îc ®­a vµo vector p2K7 b»ng T4 ligase ®Ó t¹o ra cÊu tróc víi 35S promoter vµ Nos terminator. Vector t¸i tæ hîp nµy ®­îc biÕn n¹p vµo E. coli TOP 10F' vµ ®­îc chän läc b»ng khuÈn l¹c xanh/tr¾ng trªn m«i tr­êng LB ®Æc cã 50mg/l kanamycin. C¸c khuÈn l¹c tiÕp tôc ®­îc sµng läc b»ng PCR vµ t¸ch plasmid ®Ó c¾t víi enzim giíi h¹n (¶nh 6). Dßng 1, chóng t«i ®· nhËn b¨ng ADN ~900bp vµ ~ 6Kb. B¨ng 900bp lµ gen PRSVN vµ 6Kb lµ phÇn cña vector p2K7. Trong c¸c dßng 3, 4, 5 c¸c b¨ng ADN còng ®· nhËn ®­îc t­¬ng øng ~630bp, ~725 vµ ~ 590 lµ c¸c b¨ng ®­îc c¾t ra tõ gen PRSVN. Dßng 6 cã b¨ng ADN ~ 2,8Kb lµ gen PRSVN g¾n víi 35S promoter vµ Nos terminater. KÕt qu¶ nµy cho thÊy gen PRSVN ®· ®­îc g¾n 35S promoter vµ Nos terminator trong p2K7 vector. ¶nh 6: Ph©n tÝch enzim giíi h¹n ®Ó kiÓm tra cÊu tróc vector p2K7 cã chøa gen PRSVN Dßng M: Marker 1Kb Dßng 1: p2k7-PRSVN ®­îc c¾t víi Xba I & Sac I Dßng 2: p2k7-PRSVN ®­îc c¾t víi Xba I & Ban II Dßng 3: p2k7-PRSVN ®­îc c¾t víi Dra I & Sac I Dßng 4: p2k7-PRSVN ®­îc c¾t víi Xba I & Nde I Dßng 5: p2k7-PRSVN ®­îc c¾t víi Xba I & Nru I Dßng 6: p2k7-PRSVN ®­îc c¾t víi Hind III & Kpn I Dßng 7: p2k7-PRSVN kh«ng c¾t CÊu tróc 35S pro - gen PRSVN - Nos ter (b¨ng 2,8Kb) ®· ®­îc tinh s¹ch vµ ®­îc ®­a tiÕp vµo vector chuyÓn gen pCAMBIA ®· më b»ng enzim Hind III vµ Kpn I. Vector t¸i tæ hîp nµy ®­îc biÕn n¹p vµo Agrobacterium vµ ®­îc chän läc b»ng khuÈn l¹c xanh/tr¾ng trªn m«i tr­êng LB ®Æc cã 50mg/l kanamycin. C¸c khuÈn l¹c tiÕp tôc ®­îc sµng läc b»ng PCR vµ t¸ch plasmid ®Ó c¾t víi enzim giíi h¹n (¶nh 7). ¶nh 7: kÕt qu¶ c¾t víi enzim giíi h¹n ®Ó kiÓm tra cÊu tróc vector pCAMBIA2300 cã chøa gen PRSVN Dßng M: Marker 1Kb Dßng 1: p2300-PRSVN ®­îc c¾t víi Xba I & Sac I Dßng 2: p2300-PRSVN ®­îc c¾t víi Xba I & Nru I Dßng 3: p2300-PRSVN ®­îc c¾t víi Hind III & Kpn I Dßng 1, chóng t«i ®· nhËn ®­îc b¨ng ADN ~900bp, ~9,6Kb vµ b¨ng ~800bp. B¨ng ADN 900bp lµ gen PRSVN cßn l¹i hai b¨ng 9,6Kb vµ 800bp ®­îc c¾t ra tõ vector pCAMBIA2300, 35S pro vµ Nos ter. ë dßng 2 cã b¨ng ~590bp lµ ®­îc c¾t tõ gen PRSVN. ë dßng 3 nhËn ®­îc b¨ng 2,8Kb lµ cÊu tróc 35S pro- gen PRSVN - Nos ter. Nh­ vËy vector chuyÓn gen ®· ®­îc t¹o ra víi mét cÊu tróc ®óng. 3.8 BiÓu hiÖn gen PRSVN Gen PRSVN ®· ®­îc ®­a vµo vector pRSETA vµ ®­îc biÕn n¹p vµo chñng E.coli kÕt qu¶ ®­îc kiÓm tra b¨ng c¾t víi enzim giíi h¹n (¶nh 8) ¶nh 8: kÕt qu¶ c¾t víi enzime giíi h¹n ®Ó kiÓm tra cÊu tróc vector pRSETA cã chøa gen PRSVN DßngM: Marker 1Kb Dßng 1: pRSETA-PRSVN ®­îc c¾t víi Xho I & Nco I Dßng 2: pRSETA-PRSVN ®­îc c¾t víi Nde I Dßng 3: pRSETA-PRSVN ®­îc c¾t víi Hind III & Dra I Dßng 4: pRSETA-PRSVN kh«ng c¾t A: Clone 1 B: Clone 6 Dßng 1, chóng t«i nhËn ®­îc b¨ng ADN ~1,1 Kb, ~2,9 Kb. B¨ng 1,1Kb lµ gen PRSVN cã kÌm víi Nos ter, cßn b¨ng 2,9Kb lµ phÇn cña vector pRSETA. ë dßng 3 vµ 4 cã b¨ng ADN t­¬ng øng ~ 690bp vµ 590 bp ®­îc c¾t ra tõ gen PRSVN. KÕt qu¶ c¾t víi enzim ®óng nh­ tr×nh tù gen qui ®Þnh. Nh­ vËy cÊu tróc pRSETA-PRSVN nhËn ®­îc lµ chÝnh x¸c. Plasmid pRSETA-PRSVN ®­îc biÕn n¹p l¹i vµo chñng E.coli BL21(DE3) ®Ó biÓu hiÖn gen PRSVN. ¶nh 9: Sù biÓu hiÖn gen PRSVNtrong E.coli b»ng ®iÖn di protein tæng sè trªn gel acrylamide 12%(tr¸i) vµ Western blotting(ph¶i) Dßng M: Protein marker 200; 118; 78; 47.1; 31.4; 25.5; 13.8; 8.3 kD Dßng 1: Protein tæng sè ®èi chøng ©m t¸ch tõ chñng E.coli BL21(DE3)(mÉu 1) Dßng 2: Protein tæng sè chøa ®ùng protein PRSVN cña PRSV cña ViÖt Nam t¸ch tõ chñng E. coli BL21(DE3). Dßng 3: Protein tæng sè ®èi chøng ©m t¸ch tõ chñng E.coli BL21(DE3)(mÉu 2) Dßng 4: Protein tæng sè chøa ®ùng protein CP cña PRSV cña Malaysia t¸ch tõ chñng E. coli BL21(DE3). Sau khi protein tæng sè ®­îc cè ®Þnh trªn mµng, lai víi kh¸ng thÓ vµ ph¸t hiÖn b»ng nhuém BCIP/NBT , b¨ng protein ~40kD ®· xuÊt hiÖn trªn dßng 2 mµ kh«ng thÊy xuÊt hiÖn trªn dßng 1 vµ 3 lµ mÉu ®èi chøng ©m. B¨ng protein nµy t­¬ng øng víi b¨ng protein CP cña PRSV cña Malaysia ë dßng 4. §iÒu nµy cho thÊy r»ng protein qui ®Þnh bëi gen PRSVN cña PRSV cña ViÖt Nam ®· ®­îc biÓu hiÖn. Nh­ vËy gen PRSVN ®· ®­îc ®­a vµo pCAMBIA2300 cã kh¶ n¨ng dÞch m· sang protein b×nh th­êng. PhÇn 4 KÕt luËn vµ kiÕn nghÞ KÕt luËn 12 mÉu l¸ ®u ®ñ bÞ nhiÔm PRSV thu tõ 12 ®Þa ph­¬ng kh¸c nhau ®· ®­îc t¸ch ARN tæng sè vµ sµng läc PRSV.Trong sè mÉu sµng läc, chóng t«i chØ x¸c ®Þnh ®­îc mét dßng PRSV. Nh­ vËy, cã thÓ ë ViÖt Nam chØ cã mét dßng PRSV g©y bÖnh cho ®u ®ñ. Gen PRSVN (gen CP) ®· ®­îc x¸c ®Þnh tr×nh tù vµ so s¸nh víi tr×nh tù c¸c gen CP kh¸c trong ng©n hµng gen, møc ®é gièng nhau tõ 86,7% ®Õn 96,8 %. Tr×nh tù nµy ®· ®­îc kiÓm tra b»ng c¾t víi c¸c enzim giíi h¹n. Gen PRSVN ®· ®­îc kh¼ng ®Þnh b»ng sù nh©n lªn ®o¹n ®Æc hiÖu cho gen CP cña PRSV vµ c¶ ë møc ®é biÓu hiÖn ra s¶n phÈm protein Gen PRSVN nµy ®· ®­îc ®­a vµo vector chuyÓn gen pCAMBIA2300 vµ ®­îc biÕn n¹p vµo chñng Agrobacterium LBA 4404 s½n sµng cho chuyÓn gen. PhÇn 5 Tµi liÖu tham kh¶o Cuozzo M, K.M.O'Connell, W.Kaniewski, R.Fang, N.Chua, and N.E.Tumer. 1988. Viral protection in transgenic tobacco plants expressing the cucumber mosaic virus coat protein or its antisense RNA. Bio/Technology 6: 549-557. Fitch M.M.M, R.M. Manshardt, D. Gonsalves, J.L. Slightom, J.C. Sanfort.1992. Virus-resistant papaya plants derieved from tissues bombarded with the coat protein of papaya ringspot virus. Bio/Technology 10; 1466-1472. Fitch M.M.M, R.M. Manshardt, D. Gonsalves, J.L. Slightom, J.C. Sanfort. 1990. Stable trasformation of papaya via microprojectile bombardment. Plan Cell Rep 9: 189-194. Hemenway C, R.Fang, W.Kaniewski, N. Chua, N.E.Turner. 1998. Analysis of the mechanism of protection in transgenic plants expressing the potato virus X coat protein or its antisense RNA. EMBO J. 7: 1273-1280. Linder R.C, D.D. Jensen, W. Ikeda, 1945, Ringspot: new papaya plunder. Hawaii Farm and Home 8(10): 10-14. Loesch-Fries L.S, D. Merlo, T. Zinnen, L. Burhop, K. Hill, K. Krahn. 1987. Expression of alfalfa mosaic virus RNA 4 in transgenic plants confers virus resistance. EMBO Journal 6: 1845-1851. Namba R, S.Y. Higa. 1977. Retention of the inoculativity of the papaya mosaicvirus by the green peach aphid. Proc. Hawaii Entomol. Soc. 22:491-494. Nelson R.S, S.M. McCormick, X. Delannay, P.Dube, J.Layton, E.J.Anderson. 1988. Virus tolerance, plant growth and field performance of transgenic tomato plants expressing coat protein gene of tobacco mosaic virus. Bio/Tecnology 6:403=409. Nishina M.S, S.J. Ferreira , R.M. Manshardt, C.G. Cavaletto, E. Llantero, l. Mochida, D. Perry. 1998. Production requirements of the transgenic papayas' US Rainbow and UH Sunup'. New Plant for Hawaii. April 1998 NPH-2. Cooperative Extension Service. CTAHR, Univ.Hawaii. Ong C.A. 1991. Status and control strategy of papaya ringspot virus in Johore. Paper present at the Third National Fruit Symposium 1991. Genting Highlands, Malaysia,24-26 september 1991, MARDI, Serdang, Malaysia. Opina O.S, 1986, Studies on a new virus disease of papaya in Philippines. In: Plant virus disease of horticulture crops in the tropics and Subtropics. FFTC Book Series No 33, Taipei, Taiwan, p157-178. Powell-Abel P, R.S. Nelson, B.De, N. Hoffman S, G. Roger, R.T. and Fraley. 1986. Delay of desease development in transgenic plant that express the tobacco mosaic virus coat protein gene. Science 232:738-743. Singh A.B, 1969, A new virus disease of carica papaya in India. Plant disease reporter 53; 267-269 Srisomchai T, 1975, Studies on papaya ringspot virus. NE. Regional Office of Agriculture Yearly Report:228-232. Tennant P, C. Gonsalves K. Ling, M.M.M. Fitch, R.M. Marshardt, J.L. Slightom, D. Gonsalves. 1994. Transgenic papaya expressing the coat protein gene of the Hawaiian isolate of papaya ringspot virus and a protection against isolate from different geographical regions. Phytopathology 84: 1359-1366. Thomas J.E, R.L. Dodman. 1993. The first record of papaya ringspot virus type P from Australia. Australian Plant Path.22:2-7. Vu Cong Hau. 1996. Cultivation of fruit crops in Vietnam. Argic Publishing House, Hanoi.p.225-247. Wang H.L, C.C. Wang, R.J. Chiu, M.H.Sun, 1978, Preliminary study on papaya ringspot virus in Taiwan. Plant Protection Bull. (Taiwan) 20:133-140. Yeh S.D, D.Gonsalves, H.L. Wang, R. Namba, R.J. Chiu. 1988. Control of papaya ringspot virus by cross protection. Plant Disease reporter. 72(5):375-380. Yeh S.D, D.Gonsalves. 1994. Practices and perspective of control of papaya ringspot virus by cross protection. In: Harris K.F, ed. Advances in disease vetor research. Newyork: Springer-Verlag. 237-257.

Các file đính kèm theo tài liệu này:

  • doc13.doc