Tóm tắt Luận án Phân lập và khảo sát tính chất của một số toxin mới từ nọc bò cạp đenheterometrus laoticus

Qua quá trình khảo sát và nghiên cứu nọc từ bọ cạp Heterometrus laoticus phân bố ở An Giang, một số kết quả sau đã được ghi nhận tóm tắt như sau. 1. Bọ cạp Heterometrus laoticus trong tự nhiên do bị ảnh hưởng bởi môi trường xung quanh, cạnh tranh nguồn thức ăn, chống lại kẻ thù nên lượng nọc thô bọ cạp tương đối nhiều. Trong điều kiện nuôi trong phòng thí nghiệm, bọ cạp ít vận động, thức ăn và nước được cung cấp đầy đủ nên trọng lượng bọ cạp tăng nhiều, lượng nọc thu được giảm đáng kể theo thời gian nuôi. Điều kiện nuôi thử nghiệm trong phòng thí nghiệm như sau :  Số lượng bọ cạp trung bình dưới 50 con 1 thau nuôi  Cho ăn 1 tuần 1 lần, trung bình 2,00 g dế/bọ cạp.  Lượng nọc thu được của 850 con bọ cạp trong 6 tháng nuôi là 6,9653 g nọc, trung bình 8,19 mg/con.

pdf22 trang | Chia sẻ: tueminh09 | Ngày: 26/01/2022 | Lượt xem: 464 | Lượt tải: 0download
Bạn đang xem trước 20 trang tài liệu Tóm tắt Luận án Phân lập và khảo sát tính chất của một số toxin mới từ nọc bò cạp đenheterometrus laoticus, để xem tài liệu hoàn chỉnh bạn click vào nút DOWNLOAD ở trên
BỘ GIÁO DỤC VÀ ĐÀO TẠO VIỆN HÀN LÂM KHOA HỌC VÀ CÔNG NGHỆ VIỆT NAM HỌC VIỆN KHOA HỌC VÀ CÔNG NGHỆ VÕ ĐỖ MINH HOÀNG PHÂN LẬP VÀ KHẢO SÁT TÍNH CHẤT CỦA MỘT SỐ TOXIN MỚI TỪ NỌC BÒ CẠP ĐENHETEROMETRUS LAOTICUS Chuyên ngành: Hóa hữu cơ Mã số: 62.44.27.01 TÓM TẮT LUẬN ÁN TIẾN SĨ HOÁ HỮU CƠ TP. Hồ Chí Minh – 2017 BỘ GIÁO DỤC VÀ ĐÀO TẠO VIỆN HÀN LÂM KHOA HỌC VÀ CÔNG NGHỆ VIỆT NAM HỌC VIỆN KHOA HỌC VÀ CÔNG NGHỆ VÕ ĐỖ MINH HOÀNG PHÂN LẬP VÀ KHẢO SÁT TÍNH CHẤT CỦA MỘT SỐ TOXIN MỚI TỪ NỌC BÒ CẠP ĐENHETEROMETRUS LAOTICUS Chuyên ngành: Hóa hữu cơ Mã số: 62.44.27.01 TÓM TẮT LUẬN ÁN TIẾN SĨ HOÁ HỮU CƠ NGƯỜI HƯỚNG DẪN KHOA HỌC: 1. TSKH. Hoàng Ngọc Anh 2. GS. TSKH. Utkin Yuri Nikolaevich TP. Hồ Chí Minh – 2017 Trang 1 1. MỞ ĐẦU Cùng với sự phát triển về kinh tế, xã hội của thế giới, việc nghiên cứu, tìm tòi, và phát triển tìm ra các loại dược phẩm mới để chữa trị bệnh cho con người là vấn đề ngày càng cấp bách của xã hội và khoa học. Bên cạnh việc tổng hợp các loại thuốc chữa bệnh có nguồn gốc từ thực vật thì nọc độc động vật đang là nguồn dược liệu quý hiếm để bổ sung cho việc tổng hợp các nguồn thuốc mới. Từ lâu, nọc độc các loài động vật như rắn, ong, bọ cạp và nhiều loài khác đã được sử dụng làm nguyên liệu chính để chữa bệnh. Trong dân gian, bò cạp thường được dùng nguyên con (toàn yết) hoặc phần đuôi (yết vĩ) để trị động kinh ở trẻ em, uốn ván, bán thân bất toại, quai bị, méo miệng dưới dạng thuốc bột hoặc làm viên uống. Cùng với sự tiến bộ khoa học, đã có những nghiên cứu đầu tiên trên thế giới về nọc bò cạp cách đây hơn 100 năm và đã xác định nọc độc bò cạp có hoạt tính về thần kinh. Tuy nhiên, việc nghiên cứu nọc bò cạp ở Việt Nam chỉ mới ở giai đoạn bắt đầu, chưa có nhiều nghiên cứu được công bố về việc ứng dụng nọc bò cạp làm thuốc trị bênh cho con người mà chỉ là những bài thuốc dân gian được truyền miệng chưa có nhiều kiểm chứng khoa học. Trong nọc bò cạp chứa nhiều các polypeptide có khả năng tác động lên các thụ thể và các kênh ion của màng tế bào bị kích thích, các loại polypeptide này đã và đang được các nhà khoa học nghiên cứu nhằm tạo ra các thuốc mới chữa các bệnh như: Parkinson, cao huyết áp, ung thư, Alzheimer... Nhằm đóng góp một nguồn nguyên liệu mới và các nghiên cứu khoa học mới cho ngành dược, hướng tới làm thuốc chữa bệnh và làm cơ sở cho những nghiên cứu tiếp theo, nhóm nghiên cứu chúng tôi đã tiến hành các nghiên cứu về nọc bò cạp Heterometrus laoticus. Qua đề tài “Phân lập và khảo sát tính chất toxin của một số toxin mới từ nọc bò cạp Heterometrus laoticus”, đây là hướng nghiên cứu mới về nọc bò cạp Heterometrus laoticus với hi vọng sẽ mang đến cơ sở cho những nghiên cứu tiếp theo về việc ứng dụng của nọc bò cạp dùng làm nguồn nguyên liệu cho dược phẩm. Trang 2 2. PHƯƠNG PHÁP NGHIÊN CỨU Bọ cạp đen Heterometrus laoticus được thu mua ở tỉnh An Giang thành 2 đợt, đợt 1 vào tháng 5 và đợt 2 vào tháng 8 với tổng số 2 lần là 850 cá thể. Bọ cạp thu mua sau đó được nuôi trong phòng thí nghiệm để lấy nọc phục vụ cho các nghiên cứu. Để thu nọc bọ cạp từ phần đuôi có chứa túi nọc, bọ cạp được kích thích trực tiếp vào phần đuôi (đốt thứ 5 hoặc đốt thứ 6) sử dụng một dòng điện một chiều có tần số kích thích là 2,63kHz và được duy trì trong suốt quá trình tiết nọc của bọ cạp (5 – 7 giây). Bọ cạp được giữ cố định trên một bản kim loại, bản kim loại này được nối với cực âm của nguồn điện. Điện cực dương được sử dụng để kích thích trực tiếp vào phần đuôi chích để bọ cạp tiết hoàn toàn nọc có trong túi nọc ra ngoài. Nọc được bọ cạp tiết ra được thu trên các lam thủy tinh mỏng dưới dạng chất lỏng không màu hoặc có màu trắng sữa đục. Nọc sau khi thu được làm khô trong bình hút ẩm có chứa CaCl2 khan trong khoảng 4 giờ. Nọc sau khi khô được gom lại trong một lọ thủy tinh nhỏ và bảo quản trong tủ lạnh ở nhiệt độ -20oC cho đến khi sử dụng. Bọ cạp sau khi mua về để ổn định một ngày rồi tiến hành lấy nọc, khoảng cách giữa hai lần lấy nọc liên tiếp là hai tuần. Nọc thô được tinh chế thành các phân đoạn nhỏ hơn sử dụng phương pháp sắc ký lọc gel trên gel Sephadex G-50 và sắc ký lỏng hiệu năng cao. Các phân đoạn nọc thu được tiếp tục được đánh giá độc tính trên chuột và dễ và nghiên cứu cấu trúc sử dụng phổ cộng hưởng từ hạt nhân và khối phổ. Trang 3 3. KẾT QUẢ VÀ BIỆN LUẬN 3.1 Định danh bọ cạp đen thumẫu tại An Giang Bọ cạp đen được tiến hành thu mẫu tại vùng An Giang, miền Nam, Việt Nam. Sau đó, mẫu vật bọ cạp được tiến hành vận chuyển sang Pháp, gửi mẫu tại phòng Sinh thái môi trường thuộc Viện Bảo tàng lịch sử Quốc gia Pháp của Tiến sỹ khoa học Wilson R. Lourenco để tiến hành định danh bọ cạp. Kết quả xác định mẫu bọ cạp ở vùng An Giang thuộc loại Heterometrus laoticus. (Phụ lục 1) 3.2. Nuôi bọ cạp trong phòng thí nghiệm và thu hoạch nọc Bọ cạp H. laoticus sau khi thu mua tại vùng An Giang (2 đợt, 850 cá thể) được chia vào các thau để tiến hành thử nghiệm nuôi nhốt trong phòng thí nghiệm, mỗi thau có số lượng trung bình từ 65-75 cá thể, tiến hành nuôi và theo dõi trong 06 tháng cho kết quả như hình 3.1. Trang 4 Hình 3.1. Lượng nọc bọ cạp thu được theo thời gian. Lượng nọc thu được từ bọ cạp nuôi trong phòng thí nghiệm giảm dần theo thời gian nuôi. Trong phòng thí nghiệm, bọ cạp được nuôi với mật độ khá lớn so với tự nhiên, không gian hoạt động ít, thức ăn được cung cấp đầy đủ nên không có tình trạng cạnh tranh nguồn thức ăn cũng như chống lại kẻ thù trong môi trường tự nhiên. 3.3. Khảo sát, đánh giá và phân tích nọc thô bọ cạp H. laoticus 3.3.1. Phân tích hàm lượng protein tổng trong nọc thô Lượng protein có trong nọc thô được xác định bằng phương pháp so màu biuret với đường chuẩn được xây dựng bằng các nồng độ dung dịch albumin khác nhau. Từ kết quả xây dựng đường chuẩn và phương trình hồi quy của đường chuẩn tính toán được nồng độ protein có trong nọc H. laoticus thu được là 1,293 mg/mL và từ đó xác định được hàm lượng của protein tan trong nước của dung dịch nọc thô lấy từ bọ cạp là 64,65%. 3.3.2. Phân tích nọc bọ cạp bằng sắc ký lọc gel trên gel Sephadex G50 và xác định khối lượng phân tử các phân đoạn Thực hiện sắc ký lọc gel trên gel Sephadex G – 50 với 4.500 mg nọc thô tại Phòng Các chất có hoạt tính sinh học, Viện Sinh học Nhiệt đới, thu được 5 phân đoạn nọc với tỷ lệ khối lượng từng phân đoạn được thể hiện trong bảng 3.1. 0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 0,7594 0,6106 0,5737 0,3942 0,3529 0,489 0,93 0,5652 0,6628 0,4864 0,3758 0,23610,21680,1996 L ư ợ n g n ọ c th ô t h u đ ư ợ c (m g ) Số lần Đợt 2 Trang 5 Bảng 3.1. Khối lượng các phân đoạn nọc bọ cạp. Phân đoạn Lượng nọc (mg) Tỉ lệ (%) 1 102,7 5,42 2 174,2 9,20 3 253,2 13,37 4 688,9 36,39 5 674,2 35,61 Tổng khối lượng 1.893,2 Bằng sắc ký lọc gel, nọc thô từ loài bọ cạp H.laoticusđã được phân tách thành 5 phân đoạn nọc khác nhau tương ứng với các khối lượng phân tử khác nhau. Khối lượng phân tử của 5 phân đoạn này được xác định sơ bộ bằng phương pháp SDS-PAGE và so sánh với mẫu chuẩn khối lượng (hình 3.2). Hình 3.2. Kết quả điện di 5 phân đoạn nọc so với mẫu chuẩn. kDa M 1 Sg 1 Sg 2 Sg 3 Sg 4 Sg 5 10 15 25 35 40 55 70 100 130 170 Trang 6 3.3.3. Khảo sát độc tính của các phân đoạn của nọc bọ cạp H. laoticus đối với chuột Bảng 3.2.. Kết quả thử độc tính trên chuột của các phân đoạn nọc. Phân đoạn Biểu hiện của chuột sau khi tiêm các phân đoạn Nhận xét 1 Chuột gãi mõm, nằm im sau đó hoạt động bình thường. Không độc 2 Chuột giảm hoạt động, xù lông, thở gấp nhưng phục hồi sau 30 phút. Độc nhẹ 3 Chuột nằm im, chảy nước bọt, liệt chi, thở gấp nhưng phục hồi sau 2 giờ. Độc 4 Chuột nằm im, mắt nhắm, co giật, liệt chi, chảy nước bọt, chuột tử vong sau 3 giờ. Độc gây chết 5 Chuột run, nằm im, hoạt động bình thường sau 60 phút. Không độc Nước cất Chuột run, nằm im, sau đó bình thường Không độc Phân đoạn 4 được tách ra từ nọc thô bọ cạp H. laoticus bằng phương pháp sắc ký lọc gel, thông qua thử nghiệm độc tính lên chuột cho thấy phân đoạn 4 có độc tính gây chết. Vì vậy, phân đoạn 4 được xác định độc tính cấp đối với chuột và đạt được kết quả độc tính cấp của phân đoạn 4 tách ra từ nọc thô bọ cạp Heterometrus laoticus là LD50 = 24, 07 ± 1,09 mg/kg.Phân đoạn 4 sau khi được xác nhận có độc tính mạnh được tiếp tục phân tách bằng HPLC để thu được các phân đoạn thứ cấp (hình 3.3) Hình 3.3. Sắc ký đồ khi phân tách phân đoạn 4 bằng HPLC Các phân đoạn thứ cấp của phân đoạn 4 tiếp tục được đánh giá độc tính trên chuột và cho kết quả tóm tắt trong bảng 3.2. Các phân đoạn thứ cấp có độc tính (phân đoạn 4.6, 4.7, 4.11 và 4.15) được tiếp tục tinh chế và xác định khối lượng phân tử của các peptide thành phần. Trang 7 Bảng 3.3. Kết quả thử độc tính các phân đoạn thứ cấp Phân đoạn Độc tính Phân đoạn Độc tính 4.1 Không độc 4.14 Không độc 4.2 Không độc 4.15 Gây độc 4.3 Gây độc 4.16 Không độc 4.4 Không độc 4.17 Không độc 4.5 Gây độc 4.18 Không độc 4.6 Độc gây chết 4.19 Không độc 4.7 Gây độc 4.20 Không độc 4.8 Không độc 4.21 Không độc 4.9 Không độc 4.22 Không độc 4.10 Không độc 4.23 Không độc 4.11 Gây độc 4.24 Không độc 4.12 Không độc 4.25 Không độc 4.13 Không độc Nước muối sinh lý Không độc 3.4. Tinh chế và xác định khối lượng phân tử các phân đoạn thứ cấp Phân đoạn 4.6 được phân tách ra thành 3 phân đoạn gồm 4.6.1, 4.6.2, 4.6.3. Phân đoạn 4.6.1 thu được lượng mẫu tương đối ít, trong khi đó ở phân đoan 4.6.2 và 4.6.3 lượng mẫu thu được nhiều nên được tiếp tục tinh chế để xác định khối lượng phân tử. Kết quả cho thấy phân đoạn thứ cấp 4.6.2 có khối lượng phân tử 3.669,155 Da, còn phân đoạn thứ cấp 4.6.3 có khối lượng phân tử 2.915,040 Da. Phân đoạn 4.7 tách ra 4 phân đoạn. Trong đó, peptide 4.7.2 được tinh chế và khảo sát khối lượng phân tử, kết quả cho thấy peptide 4.7.1 có khối lượng phân tử là 3.700,2 Da và peptide 4.7.2 có khối lượng phân tử là 3.846,872 Da. Phân đoạn 4.11 đã tách được 01 peptide 4.11.1 sạch và xác định khối lượng phân tử của nó là 3.695,907 Da. Phân đoạn 4.15 đã tách ra làm 8 phân đoạn peptide. Trong số đó, chúng tôi đã làm sạch và xác định khối lượng phân tử của ba peptide của phân đoạn thứ cấp 4.15.8 là 2.461,105 Da ; 3.285,285 Da và 5.021,4 Da. 3.5. Khảo sát cấu trúc bậc một của các polypeptide phân đoạn 4.6 và tác động lên kênh K+ 3.5.1. Khảo sát cấu trúc bậc một của các polypeptide phân đoạn 4.6 Bảng 3.4. Khối lượng phân tử của các polypeptide tách ra. Trang 8 Phân đoạn Khối lượng phân tử (Da) 4.6.2 (Hetlaxin) 3.670,8 4.6.3 2.915,4 4.7.1 3.700,2 4.7.2 3.846,2 4.11 3.700,3 2.461,1 4.15 3.285,3 5.021,4 Các polypeptide từ phân đoạn 4.6.2 (đặt tên là Hetlaxin) và 4.6.3 được khử, sau đó peridylethyl hóa và phân tích bằng khối phổ để xác định số lượng cầu disulfide trong cấu trúc. Kết quả cho thấy có tín hiệu phù hợp với khối lượng 4.498 Da (cho peptide từ phân đoạn 4.6.2) và tín hiệu phù hợp với khối lượng 3.538 Da (cho peptide từ phân đoạn 4.6.3) đã thu được trong khối phổ MALDI. Sự tăng khối lượng tương ứng với với 8 nhóm pyridylethyl trong phân tử Hetlaxin và 6 nhóm trong polypeptide từ phân đoạn 4.6.3. Điều này cho thấy Hetlaxin chứa 4 cầu disulfid và polypeptide từ phân đoạn 4.6.3 chứa 3 cầu disulfid. Phần cuối N của chuỗi polypeptide của Hetlaxin đã được xác định bằng phương pháp thoái hóa Edman là ISXTGSXQ. Trình tự amino acid của Hetlaxin cũng đồng thời được phân tích bằng khối phổ MALDI (Hình 3.4). Hình 3.4. Phân tích trình tự amino acid của Hetlaxin bằng khối phổ. Cùng một lúc thực hiện vỡ mảnh MS/MS hoàn toàn của chuỗi peptide và xác định khối lượng peptide bằng phương pháp dấu bàn tay nhờ trypsin. Dựa trên dữ liệu của thoái hóa Edman và khối phổ trong hay 3.18 trình tự các amino acid của Hetlaxin có thể được xác định. Dữ liệu khối phổ MS/MS của mảnh peptide thu được dưới tác động của trypsin chỉ ra rằng gốc cystein ở đầu cuối -C đã bị amide hóa và gốc lysin ở vị trí 30 đã được tìm thấy bằng phương pháp xác định trình tự amino Trang 9 acid bằng MS/MS của mảnh thu được dưới tác động của trypsin. Cấu trúc của Hetlaxin đã được xác định như trong hình 3.5. KCYDPCKKKTGC KKTGCPNAKCMNK Khối phổ IS QCYD KKTGCPNAKCMNKSC CYGC ISCTGSKQCYDPCKKKTGCPNAKCMN ISXTGSXQ Thoái hóa Edman ISCTGSKQCYDPCKKKTGCPNAKCMNKSCKCYGC Trình tự Hetlaxin Hình 3.5. Cấu trúc bậc 1 của Hetlaxin So sánh trình tự amino acid của Hetlaxin với trình tự amino acid của các alpha-toxin có tương tác với kênh kali (Hình 3.6) cho thấy Hetlaxin là đồng đẳng của các toxin này. Hetlaxin có sự tương đồng cao với toxin AFB73769, trình tự amino acid của toxin này được suy ra từ sản phẩm của cDNA (tổng hợp) thu được từ tuyến nọc của bọ cạp H. laoticus của Thái Lan, cho đến nay vẫn chưa có tài liệu về hoạt tính sinh học của toxin này. Một toxin tương đồng khác (HsTX1-P59867 và toxin Vm24- P0DJ31những toxin này có tương tác mạnh với kênh Kali Kv1.1 và Kv1.3 (Hình 3.6). 1 10 20 30 ISCTGSKQCY DPCKKKTGCP NAKCMNKSCK CYGC* HETLAXIN ISCTGSKQCY DPCKRKTGCP NAKCMNKSCK CYGCG AFB73769 IRCSGSRDCY SPCMKQTGCP NAKCINKSCK CYGC* P84094(KAX6D_HETSP) ASCRTPKDCA DPCRKETGCP YGKCMNRKCK CNRC* P59867 (KAX63_HETSP) AAAISCVGSPECP PKCRAQ-GCK NGKCMNRKCK CYYC* P0DJ31 (KA211_VAEMS) AAAISCVGSKECL PKCKAQ-GCK SGKCMNKKCK CY-CP P0DJ32(KA212_VAEMS) Hình 3.6. So sánh sự tương đồng của hetlaxin với các toxin khác. Kết hợp với phân tích khối phổ MS và MS/MS và dữ liệu thu được khi thực hiện phương pháp thoái hóa Edman, cấu trúc của phân đoạn 4.6.2 đã được xác định. Sự tương tác của các peptide tách ra với kênh Kv1.3 cũng được xem xét, từ đó nhận định chuỗi polypeptide đã cô lập được là một toxin mới và tạm được đặt tên là Hetlaxin. Hetlaxin thuộc họ alpha-toxin, đây là một trong những toxin đầu tiên tách ra từ H.laoticus và có ái lực mạnh với kênh kali Kv1.3. Trong khi đó Hetroscorpin -1 (HS-1) toxin tách ra từ H.laoticus tại Thái Lan có trình tự amino acid khác xa so với Hetlaxin và không có báo cáo nào về tách dụng trên kênh thần kinh K, HelaTx1 cũng tách từ bọ cạp này thì lại không có tương tác mạnh trên kênh Kv1.3 như Hetlaxin. Trang 10 3.5.2. Khảo sát tác động của Hetlaxin lên kênh K+ Sự tương tác của Hetlaxin với cổng dẫn truyền ion K+ của các kênh kali đã được nghiên cứu trong các thí nghiệm cạnh tranh liên kết. Chimeric protein KcsA-Kv1.3 và KcsA-Kv1.1, biểu hiện khác loài trong màng E. coli, đã được sử dụng như các kênh K+ và R-AgTx2 được sử dụng như một phối tử. Sự liên kết của R-AgTx2 được ghi nhận nhờ kính hiển vi đồng tiêu quét laser. Có thể thấy rằng Hetlaxin cạnh tranh hiệu quả với R-AgTx2 trong liên kết với cả hai kênh chimeric (Hình 3.7). Các giá trị IC50 được xác định là 0,48 ± 0,01 μM và 6,7 ± 0,4 μM tương ứng cho Kv1.3 và Kv1.1, trong khi đó giá trị Ki được tính sử dụng phương trình Cheng-Prusoff là 59 ± 6 nM và 0,8 ± 0,3 M. Những số liệu này cho thấy Hetlaxin tương tác hiệu quả với kênh kali Kv1.3, trong khi đó sự tương tác với kênh Kv1.1 thấp hơn khoảng mười lần. [53,87] Hình 3.7.. Sự cạnh tranh của Hetlaxin với R-AgTx trong liên kết với kênh kali KcsA-Kv1.1 (A) và KcsA-Kv1.3 (B) Cho đến thời điểm hiện tại, từ loài H. laoticus phân bố ở Thái Lan chỉ có hai toxin đã được cô lập và xác định trình tự là Hetroscorpin-1 (HS-1) và HelaTx1. HS-1 có khối lượng phân tử của 8.293 Da, chứa 6 gốc cysteine và thuộc họ scorpine có độc tính với côn trùng và có hoạt tính kháng khuẩn nhưng không có báo cáo nào về sự tương tác của HS-1 với các kênh kali. HelaTx1 có khối lượng phân tử 2.763 Da và chứa 4 gốc cysteine, có khả năng tương tác với các kênh kali khác nhau và tương tác mạnh nhất với kênh Kv1.1 (EC50 = 9,9 ± 1,6 μM). HelaTx1 cũng liên kết với kênh Kv1.3, tuy nhiên ái lực liên kết thấp hơn nhiều so với kênh Kv1.1. Ở nồng độ 30 μM, toxin HelaTx1 chỉ tương tác 20 % đối với kênh kali. Dựa trên các kết quả thử nghiệm khả năng liên kết với kênh kali của protein từ Hetlaxin cô lập từ nọc loài H. laoticus phân bố ở Việt Nam cho thấy khả năng liên kết và ức chế hoạt động của kênh kali Kv1.3 và Kv1.1. Đối với kênh Kv1.3, protein mới phát hiện có khả năng ức chế ở nồng độ khá thấp, 0,48 ± 0,01 μM và 6,7 ± 0,4 μM tương ứng cho Kv1.3 và Kv1.1. Những nghiên cứu này cho thấy Hetlaxincó khả năng ức chế hoạt động kênh Kv1.3 hiệu quả hơn HelaTx1 đã được công bố và -9 -8 -7 -6 -5 -4 -3 -2 0 300 600 900 1200 lg [C] S ig n a l in te n s it y re la ti v e u n it s -9 -8 -7 -6 -5 -4 -3 -2 0 1000 2000 3000 4000 lg [C] S ig n a l in te n s it y re la ti v e u n it s A B Trang 11 là toxin có khả năng ức chế kênh Kv1.3 mạnh nhất được phân lập từ H. laoticus cho đến nay (0,48 µM). [90] [85]Trước đây, đa số báo cáo đều cho thấy rằng các toxin của nọc bọ cạpH. laoticus này đều tác dụng trên kênh thần kinh Kv1.1 và chưa có báo cáo nào chỉ rõ sự liên kết của các protein này với Kv1.3. Hetlaxin là toxin đầu tiên tại thời điểm bài viết được tách từ nọc bọ cạp H. laoticus có tác động mạnh trên kênh Kv1.3 3.6. Khảo sát độc tính của các phân đoạn của nọc bọ cạp H. laoticus lên dế 3.6.1. Kết quả khảo sát độc tính của các phân đoạn nọc thu được trên dế Các phân đoạn của nọc bọ cạp H. laoticus được thử nghiệm xác định độc tính đối với côn trùng bằng phương pháp tiêm bên bụng dế, mỗi lô gồm 6 con và tiêm đối chứng sử dụng nước cất cho kết quả như bảng 3.5. Bảng 3.5. Kết quả thử độc tính trên dế của các phân đoạn nọc. PĐ Các biểu hiện của dế Nhận xét 1 Dế nằm im, sau đó hoạt động bình thường. Không độc 2 Dế nằm im, sau đó hoạt động bình thường. Không độc 3 Dế nằm im, sau đó hoạt động bình thường. Không độc 4 Dế nằm im, sau đó hoạt động bình thường. Không độc 5 Dế hoạt động mạnh, nhảy liên tục trong bồn quan sát, sau đó nằm im, 26 phút sau dế ngừng hoạt động, tứ chi rụng ra, tử vong. Độc gây chết Nước cất Dế run, nằm im, sau đó bình thường Không độc Đối với phân đoạn 5, sau khi được tiêm trong năm phút đầu tiên, dế hoạt động mạnh, chạy nhảy liên tục. Đến phút thứ 10, dế bắt đầu nằm yên và đến phút thứ 26, dế có biểu hiện tử vong, tứ chi rụng ra. Phân đoạn 5 được xác định là phân đoạn có độc tính đối với côn trùng. 3.6.2. Xác định độc tính cấp của phân đoạn độc lên côn trùng theo đường tiêm bụng bên dế. Sau khi tiến hành tiêm bên bụng dế của các lô thử nghiệm và các lô đối chứng chúng tôi xác định được như sau :  Xác định được liều tối đa không gây chết LD0 = 20,3 µg/g.  Xác định được liều tối thiểu gây chết 100% LD100 = 393,75 µg/g  Xác định liều chết trung bình LD50 theo phương pháp Karber – Behrens theo bảng 3.7 ta có: ∑ab =1.600,52 Trang 12 n = 60/8 = 7,50 𝐿𝐷50 = 𝐿𝐷100 − ∑ 𝑎𝑏 𝑛 = 393,75 − 1600,52 7,50 = 180,35 Vậy LD50 = 180,35 µg/g Bảng 3.6. Tỷ lệ tử vong của dế ở các liều khác nhau trong khoảng LD0 và LD100 sau 24 giờ tiêm. Liều tiêm 20,30 73,65 127,00 180,35 233,70 287,05 340,40 393,75 Số dế/lô 6 8 8 8 8 8 8 6 Số dế chết 0 3 3 4 4 6 7 6 Số dế sống 6 5 5 4 4 2 1 0 Tỷ lệ chết (%) 0,00 37,50 37,50 50,00 50,00 75,00 87,50 100,00 Bảng 3.7. Bảng tính theo phương pháp Karber – Behrens. a 1,50 3,00 3,50 4,00 5,00 6,50 6,50 b 53,35 53,35 53,35 53,35 53,35 53,35 53,35 a.b 80.03 160,05 186,73 213,40 266,75 346,78 346,78 a: Số trung bình dế chết ở hai liều kế tiếp b: hiệu số giữa hai lần kế tiếp. Hình 3.8. Đồ thị tỷ lệ % dế chết theo liều dùng. Dựa vào đồ thị tỷ lệ % chuột chết theo liều dùng ta xác định liều LD16 và liều LD84 như sau: LD16 = 43,85 µg/g và LD84 = 330,65 µg/g. 0 10 20 30 40 50 60 70 80 90 100 0 100 200 300 400 L iề u t iê m ( µ g /g ) % Dế chết Trang 13 Từ đó tính được phân phối chuẩn s = 143,40, với bước nhảy liều d = 53,40. Hằng số Karber – Behrens k = 0,564. Sai số chuẩn của liều LD50 được tính theo công thức: 𝐸𝑠 = √ 𝑘 × 𝑠 × 𝑑 𝑛 Es là 23,99. Vậy độc tính cấp của phân đoạn 5 tách ra từ nọc thô bọ cạp H. laoticus là LD50 = 180,35 ± 23,99 µg/g. Như vậy bằng phương pháp Karber – Behrens chúng tôi đã xác định được độc tính cấp của phân đoạn độc với côn trùng là LD50 = 180,35 ± 23,99 µg/g. 3.6.3. Phân tách phân đoạn 5 bằng sắc ký lỏng hiệu năng cao Phân đoạn 5 sau khi được xác định có độc tính gây chết đối với côn trùng (dế), tiếp tục được phân tách để thu được các toxin nhằm xác định cấu trúc của toxin có độc tính và xác định khả năng tương tác đối với kênh kali. Phân đoạn 5 được phân tách sử dụng sắc ký lỏng hiệu năng cao pha đảo, cột Eclipse XDB C18, sắc ký đồ thu được như hình 3.23. Các phân đoạn sau khi được tách ra riêng được đánh số từ 5.1 đến 5.25 và sau đó được sử dụng để đánh giá độc tính trên dế. 3.6.4. Khảo sát độc tính lên dế đối với các phân đoạn thứ cấp Dựa vào kết quả khảo sát độc tính các phân đoạn thứ cấp lên côn trùng như bảng 3.8, 13 phân đoạn được xác định có độc tính đối với dế thử nghiệm là phân đoạn 5.3; 5.7; 5.8; 5.9; 5.10; 5.12; 5.13; 5.15; 5.17; 5.18; 5.21; 5.24. Các phân đoạn độc nhẹ tỷ lệ tử vong mỗi lô là 50 % (3/6) sau 4 giờ, các phân đoạn độc mạnh có tỷ kệ tử vong mỗi lô là 5/6 sau 4 giờ. 4 phân đoạn được xác định có độc tính mạnh (độc gây chết, tỷ lệ 5/6) lần lượt là các phân đoạn: 5.7, 5.12, 5.15, 5.21. Bảng 3.8. Kết quả thử độc tính các phân đoạn sau khi tách bằng sắc ký lỏng hiệu năng cao lên côn trùng. Phân đoạn Kết quả Phân đoạn Kết quả Phân đoạn Kết Quả 5.1 Không độc (0/6) 5.9 Độc nhẹ (3/6) 5.17 Độc nhẹ (3/6) 5.2 Không độc (0/6) 5.10 Độc nhẹ (3/6) 5.18 Độc nhẹ (3/6) 5.3 Độc nhẹ (3/6) 5.11 Không độc (0/6) 5.19 Không độc (0/6) 5.4 Không độc (0/6) 5.12 Độc mạnh (5/6) 5.20 Không độc (0/6) 5.5 Không độc (0/6) 5.13 Độc nhẹ (3/6) 5.21 Độc mạnh (5/6) Trang 14 5.6 Không độc (0/6) 5.14 Không độc (0/6) 5.22 Độc nhẹ (3/6) 5.7 Độc mạnh (5/6) 5.15 Độc mạnh (5/6) 5.23 Không độc (0/6) 5.8 Độc nhẹ (3/6) 5.16 Không độc (0/6) 5.24 Độc nhẹ (3/6) Từ kết quả sơ bộ trên, các phân đoạn độc đối với côn trùng được tiến hành tinh chế để thu được mẫu toxin sạch nhằm tiến hành xác định khối lượng phân tử của các toxin này. Hình 3.9. Sắc ký đồ của phân đoạn 5. 3.7. Cô lập và xác định khối lượng phân tử các phân đoạn thứ cấp có độc tính 3.7.1. Cô lập các polypeptide từ phân đoạn thứ cấp Các phân đoạn thứ cấp được xác định có độc tính được phân tách bằng sắc ký lỏng hiệu năng cao nhằm thu được các chuỗi polypeptide sạch để có thể phân tích xác định cấu trúc và khả năng tương tác đối kênh kali. Kết quả tóm tắt của quá trình cô lập được thể hiện trong bảng bảng 3.8. 3.7.2. Xác định cấu trúc các chuỗi polypeptide của phân đoạn 5.21 Phân đoạn 5.21 được chọn để tiếp tục tiến hành sắc ký để cô lập hai chuỗi polypetide có trong thành phần từ đó xác định các đặc tính của hai chuỗi polypeptide này. Khối lượng phân tử của hai chuỗi polypeptide được xác định bằng phương pháp khối phổ MALDI-TOF cho kết quả khối lượng phân tử của hai phân đoạn 5.21.1 và 5.21.2 lần lượt là 317,974 Da và 832,600 Da. Đây là các toxin ngắn, khác với các toxin đã được xác định có độc tính đối với côn trùng của nọc bọ cạp H. laoticus phân bố tại Thái Lan là toxin dài có khối lượng phân tử lớn 8.293,07 Da. [90] Phân đoạn 5.21.1 được xác định cấu trúc của sử dụng phổ cộng hưởng từ hạt nhân. Nhiệt độ và độ pH của mẫu thay đổi trong khoảng 10 – 45 oC và 5 – 7,5. Đầu tiên xác định hệ spin của peptide Trang 15 bằng phổ DQF-COSY, tiếp theo, bằng phổ NOESY để xác định trình tự amino acid trong chuổi peptide. Thu được kết quả phổ NMR như hình 3.38. [12,29,30,46,52,75] Hình 3.10. Phổ NMR của toxin 5.21.1 Qua hình 3.10, cho thấy các H của gốc amin cuối đã bị ion hóa. Dựa vào kết quả của phổ NMR và phổ MS đã dự đoán được cấu trúc của toxin 5.21.1 là dipeptide Leu-Trp (hình 3.11). Như vậy, ở phân đoạn 5 của nọc bọ cạp H.laoticus có độc tính đối với côn trùng, đã làm sạch được toxin của phân đoạn 5.21.1 là Leu-Trp là toxin ngắn có khối lượng phân từ là 317,974 Da. A B Trang 16 C Hình 3.11.. Cấu trúc của toxin 5.21.1 (Leu-Trp) A: Cấu trúc phẳng của Leu – Trp ; B : Vị trí các nhóm H trên phổ NMR C: Mô hình cấu trúc không gian của Leu - Trp Số lượng các dipeptide có hoạt tính sinh học được phát hiện từ thiên nhiên tính tới thời điểm của bài viết này còn rất hạn chế. Một vài dipeptide có hoạt tính sinh học được phát hiện sớm là carnosine (β-alanyl-L-histidine) và anserine (β-alanyl-N-methyl-L-histidine) được tìm thấy trong mô cơ và mô não của động vật. Cùng với homocarnosine và ophidine, các dipeptide này đã và đang được nghiên cứu do khả năng kháng oxy hoá và tiềm năng ứng dụng trong dược phẩm. Có một công bố về hoạt tính của carnosine và anserine trong khả năng điều trị một số bệnh ở người như đái tháo đường, xơ vữa động mạch, Alzheimer nhờ khả năng ngăn cản sự hình thành các sản phẩm glycat hoá (các sản phẩm glycosyl hoá protein hay lipid mà không có sự tham gia của các enzyme điều hoà). Gần đây, từ mô cơ của cá hồi Chum (Oncorhynchus keta), một số dipeptide, điển hình Phe–Leu, Ala–Trp, Val–Trp, Met–Trp, Ile–Trp, Leu–Trp, đã được tìm thấy và đã cho kết quả thử nghiệm ức chế enzyme ACE (angiotensin-converting enzyme), từ đó mang tới tiềm năng sử dụng làm thuốc điều trị bệnh tăng huyết áp. [42,50,68,79,95,100,105] Trang 17 4. KẾT LUẬN Qua quá trình khảo sát và nghiên cứu nọc từ bọ cạp Heterometrus laoticus phân bố ở An Giang, một số kết quả sau đã được ghi nhận tóm tắt như sau. 1. Bọ cạp Heterometrus laoticus trong tự nhiên do bị ảnh hưởng bởi môi trường xung quanh, cạnh tranh nguồn thức ăn, chống lại kẻ thù nên lượng nọc thô bọ cạp tương đối nhiều. Trong điều kiện nuôi trong phòng thí nghiệm, bọ cạp ít vận động, thức ăn và nước được cung cấp đầy đủ nên trọng lượng bọ cạp tăng nhiều, lượng nọc thu được giảm đáng kể theo thời gian nuôi. Điều kiện nuôi thử nghiệm trong phòng thí nghiệm như sau :  Số lượng bọ cạp trung bình dưới 50 con 1 thau nuôi  Cho ăn 1 tuần 1 lần, trung bình 2,00 g dế/bọ cạp.  Lượng nọc thu được của 850 con bọ cạp trong 6 tháng nuôi là 6,9653 g nọc, trung bình 8,19 mg/con. 2. Bằng phương pháp sắc ký lọc gel trên gel Sephadex G-50 với dung môi là đệm ammonium acetate (pH = 4,7), nọc thô của bọ cạp H. laoticus đã được tách thành 5 phân đoạn nọc trong đó có ba phân đoạn có độc tính đó là phân đoạn 2, 3 và 4. Trong ba phân đoạn độc chỉ có phân đoạn 4 là phân đoạn độc gây chết đối với chuột, còn phân đoạn 2 và 3 gây độc đối với chuột nhưng sau đó phục hồi. Khi khảo sát độc tính của các phân đoạn tách ra đối với côn trùng cho thấy phân đoạn 5 có độc tính gây chết đối với dế. So sánh kết quả điện di cho thấy phân đoạn 4 chứa các protein có khối lượng phân tử nằm trong vùng từ 3 đến 10 kDa và trong khoảng 65 kDa. Phân đoạn 5 chứa các protein có khối lượng phân tử trong khoảng 3 kDa và 9 kDa. 3. Khảo sát phân đoạn 4 có độc tính gây chết đối với chuột.  Độc tính cấp của phân đoạn 4 theo tiêm tĩnh mạch đối với chuột, liều chết trung bình LD50 là 24,07 ± 1,09 mg/kg, được xếp vào độc loại II (loại có độc tính cao) nhưng khi so sánh với độc tính cấp của nọc thô, thì phân đoạn 4 lại có độc tính yếu hơn nọc thô, điều đó có thể xác định rằng trong nọc thô, ngoài các peptide có khối lượng phân tử thấp độc đối với động vật còn các peptide có khối lượng phân tử lớn như enzyme phospholipase cũng có tác dụng độc đối với động vật, chúng tương tác với nhau làm cho độc tính của nọc thô mạnh hơn so với phân đoạn 4.  Bằng phương pháp HPLC, phân đoạn 4 đã được tách thành 25 phân đoạn thứ cấp khác nhau. Trong đó có một phân đoạn có độc tính gây chết đối với động vật đó là phân đoạn 4.6 và 5 phân Trang 18 đoạn khác có độc tính nhưng không gây chết chuột đó là các phân đọan thứ cấp 4.3, 4.5, 4.7, 4.11, 4.15.  Phân đoạn 4.6 tiếp tục được phân tách và xác định được khối lượng phân tử của các polypeptide có trong phân đoạn 4.6 : phân đoạn 4.6.2 là 3.670,8 Da, phân đoạn 4.6.3 là 2.915,4 Da, phân đoạn 4.7.1 là 3.700,2 Da, phân đoạn 4.7.2 là 3.846,2 Da, phân đoạn 4.11.1 là 3.700,3 Da, phân đoạn 4.15 là 2.461,1 Da; 3.285,3 Da; 5.021,4 Da.  Trong các polypeptide tách ra đã xác định được polypeptide ở phân đoạn 4.6.2 là toxin mới và có tác dụng mạnh với kênh Kv1.3. Toxin này được đặt tên là Heltaxin và được xếp vào họ alpha- toxin. Hetlaxin là toxin lần đầu tiên được tách ra từ H.laoticus mà có ái lực mạnh với kênh kali Kv1.3 với cấu trúc như sau : ISCTGSKQCYDPCKKKTGCPNAKCMNKSCKCYGC 4. Khảo sát phân đoạn độc đối với dế.  Xác định được độc tính cấp đối với dế (theo đường tiêm bên bụng dế) là LD50 = 180,35 ± 23,99 µg/g.  Phân đoạn độc đối với côn trùng đã xác định được 24 phân đoạn thứ cấp bằng phương pháp HPLC. Trong đó các phân đoạn độc mạnh (độc gây chết 100 % dế thử nghiệm) là các phân đoạn 5.3; 5.7; 5.8; 5.9; 5.10; 5.12; 5.13; 5.15; 5.17; 5.18; 5.21; 5.24 và phân đoạn độc nhẹ (chết 50 % dế thử nghiệm) các phân đoạn : 5.7; 5.12; 5.15; 5.21.  Đã xác định được khối lượng phân tử của phân đoạn thứ cấp 5.21.1 là 317,974 Da và phân đoạn thứ cấp 5.21.2 là 832,600 Da.  Bằng phổ cộng hưởng từ hạt nhân đã xác định được cấu trúc của toxin 5.21.1 là Leu-Trp. Trang 19 PHỤ LỤC Trang 20 Phụ lục 1. Kết quả nuôi thử nghiệm bọ cạp trong 6 tháng (05/2011 – 11/2011). Ngày tháng Số lượng bọ cạp sống (con) Số lượng bọ cạp chết (con) Lượng dế nuôi (gram) Trọng lượng trung bình của một con bọ cạp (gram) Đợt 1 Đợt 2 Đợt 1 Đợt 2 Đợt 1 Đợt 2 Đợt 1 Đợt 2 19/05/2011 500 - 0 - - - 11,78 20/5/2011 403 - 97 - 1.000 - 11,78 27/05/2011 376 - 27 - 1.000 - 14,10 03/06/2011 366 - 10 - 1.000 - 15,72 10/06/2011 334 - 32 - 800 - 17,57 20/06/2011 305 - 29 - 800 - 17,82 20/07/2011 275 - 30 - 600 - 18,06 20/08/2011 249 220 26 130 500 500 18,.63 11,23 20/09/2011 202 152 47 68 500 400 18,93 17,64 20/10/2011 150 126 52 26 300 300 19,03 18,12 20/11/2011 144 104 6 22 300 300 19,73 18,45

Các file đính kèm theo tài liệu này:

  • pdftom_tat_luan_an_phan_lap_va_khao_sat_tinh_chat_cua_mot_so_to.pdf